SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387792880|ref|YP_006257945.1| from Solitalea canadensis DSM 3403

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387792880|ref|YP_006257945.1|
Domain Number 1 Region: 51-75,111-303
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.24e-62
Family Prokaryotic proteases 0.00000778
Further Details:      
 
Domain Number 2 Region: 276-385
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-22
Family HtrA-like serine proteases 0.01
Further Details:      
 
Domain Number 3 Region: 403-481
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000021
Family HtrA-like serine proteases 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387792880|ref|YP_006257945.1|
Sequence length 498
Comment periplasmic serine protease, Do/DeqQ family [Solitalea canadensis DSM 3403]
Sequence
MKKTALTLLTACVGGMIAVGAYKVFESKQEQTIEDKQNVKFVGFNEKSSMVGSAGDVDFT
GAAAMVTPAVVHIKTTYTSTNRGQQYNPFGDMFDDFFGGGGGRGRSRQPQRASGSGVIVT
QDGYIVTNNHVVENADEIQVVLNDKRSFKGKLIGADPNTDLALVKIDGKDLPFVKYGNSD
AVKVGEWVLAVGNPFNLTSTVTAGIISAKARNIGILGDRNDPDSRPIEAFIQTDAAINPG
NSGGALVNTNGELIGVNAAIASQTGAYEGYGFAIPVNLVKKVINDILNFGAVQRGYLGVS
FTENNADFAKEKGLKTIDGVYVQEVLEGGAAAAAGVKQGDLITKIEGANIRSGSDLQEQI
GLHRPGDAVNLTVLRGGAEKSIKVVLKNSENTASLVKSTSNATFDALGGRFSPLNDAEKK
KYKVQGGVKITGLKENGILAQSDIQQGFVITRVNGKVVSSEEEVKSALNGSRNGMVNIEG
IYPDEPSSRYSFSFPAAK
Download sequence
Identical sequences H8KMH4
WP_014681992.1.74489 gi|387792880|ref|YP_006257945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]