SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294676694|ref|YP_003577309.1| from Rhodobacter capsulatus SB 1003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294676694|ref|YP_003577309.1|
Domain Number 1 Region: 466-872,914-937
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.95e-101
Family Glycine dehydrogenase subunits (GDC-P) 0.000000143
Further Details:      
 
Domain Number 2 Region: 17-436
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.77e-101
Family Glycine dehydrogenase subunits (GDC-P) 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294676694|ref|YP_003577309.1|
Sequence length 944
Comment glycine dehydrogenase [Rhodobacter capsulatus SB 1003]
Sequence
MSFTPTDYDPYDFANRRHIGPSPSEMAEMLKVVGVPSLDALIDETVPRAIRQAAPLSWPP
MTEHELHDKLREVQKKNAVMTSLIGQGYYGTATPPAIQRNVLENPAWYTAYTPYQPEIAQ
GRLEALLNYQTMVADLTGLPVANASLLDESTAAAEAMMMAERSAKSKARAFFVDLNLHPQ
TVAVLETRAAPFGIEIVKGQPDELVPDAVFGAIFQYPGTYGHVRDFTDYIAMLHEAGAIA
VVATDLLALCLLKEPGAMGADIAVGSAQRFGVPMGFGGPHAAFMSCRDSLKRTMPGRIVG
VSIDARGNKAYRLSLQTREQHIRREKATSNVCTAQALLAVIASFYAVFHGPKGLRAIAER
VHLNAVRVRDALVAAGADVAPQAFFDTITVRVGVGQQGIMAAARQHGINLRKVGEGRVGI
SIDELTDEDVLVRLLDSFGIKTVPPMGQTLGFPAEMLRETDYLTHPVFHMNRAESEMMRY
MRRLSDRDLALDRAMIPLGSCTMKLNAAAEMAPLTWHRYNSLHPFVPADQAGGYAEMIED
LTAKLCEITGYDAFSMQPNSGAQGEYAGLMTIAAYHRARGDAQRDICLIPVSAHGTNPAS
AAMAGMKVVVVKSAPNGDVDLEDFADKAAQAGDRLAACMITYPSTHGVFEETVKEICAIT
HRHGGQVYMDGANMNALVGLVKPGECGSDVSHLNLHKTFAIPHGGGGPGMGPIGVKAHLA
PYLPGHVETDGKPGAVSAAPYGSASILLISWAYCLMMGGEGLAQATRVAILNANYIAARL
KSEYPILFMGNRGRVAHECILDTRPFAEVGVTVDDIAKRLIDNGFHAPTMSWPVAGTLMV
EPTESETKAEIDRFITAMLAIREEVRDVAEGRIAAEDSPLHHAPHTVEDLVAGWDRKYSR
EQGCFPPGAFRVDKYWPPVGRVDNVYGDRNLVCTCPPVADWAAE
Download sequence
Identical sequences A0A0E2PEF4 D5ARN1
gi|294676694|ref|YP_003577309.1| WP_013066881.1.44490 WP_013066881.1.45363 WP_013066881.1.65902 WP_013066881.1.82813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]