SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156978706|ref|YP_001440965.1| from Staphylococcus aureus subsp. aureus Mu3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156978706|ref|YP_001440965.1|
Domain Number - Region: 94-202
Classification Level Classification E-value
Superfamily PH0156-like 0.00654
Family PH0156-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156978706|ref|YP_001440965.1|
Sequence length 208
Comment hypothetical protein SAHV_0375 [Staphylococcus aureus subsp. aureus Mu3]
Sequence
MKKRLLLSTFLASALILTGCASDQSDNEDHHTSTGIHAPKSAKKLETKDIFNSDKKNSDI
SDAEMKQAIEKYLSVNSDILDNKYIMQHKLDKQIDSQTKVTEKQAETLSHLSNLAVKNDL
HFKKFVTENNIPKEYKKPVELMMNYFKALNSTIANVDEDIEKLSYQPQNKINVVDVPTKY
AGDVNKKQQDKIKDFLKSKGIKSDVIDK
Download sequence
Identical sequences A0A0E1VLF5 A0A0H3JNQ2 A0A0H3JQ99 A0A299MJH7 T1Y744
gi|156978706|ref|YP_001440965.1| WP_000746679.1.100075 WP_000746679.1.100096 WP_000746679.1.10014 WP_000746679.1.100171 WP_000746679.1.100184 WP_000746679.1.100235 WP_000746679.1.10032 WP_000746679.1.100357 WP_000746679.1.100366 WP_000746679.1.100399 WP_000746679.1.10046 WP_000746679.1.100464 WP_000746679.1.10050 WP_000746679.1.100507 WP_000746679.1.100527 WP_000746679.1.100535 WP_000746679.1.100560 WP_000746679.1.100562 WP_000746679.1.100582 WP_000746679.1.100596 WP_000746679.1.100604 WP_000746679.1.100612 WP_000746679.1.100613 WP_000746679.1.100693 WP_000746679.1.100699 WP_000746679.1.100704 WP_000746679.1.100719 WP_000746679.1.100785 WP_000746679.1.100823 WP_000746679.1.100832 WP_000746679.1.100860 WP_000746679.1.100888 WP_000746679.1.1009 WP_000746679.1.100934 WP_000746679.1.100956 WP_000746679.1.10097 WP_000746679.1.100986 WP_000746679.1.101002 WP_000746679.1.101019 WP_000746679.1.101023 WP_000746679.1.101027 WP_000746679.1.101068 WP_000746679.1.101071 WP_000746679.1.101072 WP_000746679.1.101103 WP_000746679.1.10111 WP_000746679.1.101160 WP_000746679.1.101192 WP_000746679.1.101262 WP_000746679.1.101355 WP_000746679.1.101379 WP_000746679.1.101402 WP_000746679.1.101414 WP_000746679.1.101440 WP_000746679.1.101441 WP_000746679.1.10148 WP_000746679.1.1015 WP_000746679.1.101567 WP_000746679.1.101619 WP_000746679.1.101627 WP_000746679.1.101645 WP_000746679.1.10165 WP_000746679.1.101657 WP_000746679.1.101661 WP_000746679.1.101691 WP_000746679.1.101704 WP_000746679.1.101716 WP_000746679.1.101728 WP_000746679.1.101731 WP_000746679.1.101745 WP_000746679.1.101778 WP_000746679.1.101779 WP_000746679.1.101813 WP_000746679.1.101820 WP_000746679.1.101824 WP_000746679.1.101825 WP_000746679.1.101831 WP_000746679.1.101852 WP_000746679.1.101902 WP_000746679.1.101906 WP_000746679.1.101921 WP_000746679.1.101922 WP_000746679.1.101943 WP_000746679.1.102065 WP_000746679.1.102096 WP_000746679.1.102123 WP_000746679.1.102130 WP_000746679.1.102132 WP_000746679.1.10214 WP_000746679.1.10238 WP_000746679.1.10240 WP_000746679.1.10244 WP_000746679.1.10249 WP_000746679.1.1025 WP_000746679.1.10274 WP_000746679.1.10292 WP_000746679.1.10294 WP_000746679.1.10301 WP_000746679.1.1031 WP_000746679.1.10321 WP_000746679.1.10343 WP_000746679.1.10355 WP_000746679.1.1043 WP_000746679.1.10436 WP_000746679.1.10450 WP_000746679.1.10478 WP_000746679.1.10481 WP_000746679.1.10526 WP_000746679.1.10624 WP_000746679.1.10664 WP_000746679.1.10749 WP_000746679.1.10751 WP_000746679.1.1077 WP_000746679.1.10823 WP_000746679.1.10917 WP_000746679.1.10919 WP_000746679.1.10942 WP_000746679.1.10965 WP_000746679.1.10976 WP_000746679.1.10979 WP_000746679.1.10986 WP_000746679.1.11001 WP_000746679.1.11069 WP_000746679.1.11073 WP_000746679.1.11074 WP_000746679.1.11083 WP_000746679.1.11084 WP_000746679.1.1115 WP_000746679.1.11162 WP_000746679.1.11184 WP_000746679.1.11202 WP_000746679.1.11220 WP_000746679.1.11261 WP_000746679.1.11282 WP_000746679.1.11286 WP_000746679.1.11312 WP_000746679.1.11322 WP_000746679.1.11333 WP_000746679.1.11365 WP_000746679.1.11378 WP_000746679.1.11391 WP_000746679.1.11403 WP_000746679.1.11434 WP_000746679.1.11441 WP_000746679.1.11447 WP_000746679.1.11451 WP_000746679.1.1147 WP_000746679.1.11504 WP_000746679.1.1151 WP_000746679.1.11513 WP_000746679.1.1152 WP_000746679.1.11540 WP_000746679.1.11556 WP_000746679.1.11571 WP_000746679.1.11580 WP_000746679.1.11611 WP_000746679.1.11640 WP_000746679.1.11646 WP_000746679.1.11663 WP_000746679.1.1171 WP_000746679.1.11723 WP_000746679.1.11730 WP_000746679.1.11736 WP_000746679.1.11768 WP_000746679.1.11794 WP_000746679.1.11837 WP_000746679.1.11884 WP_000746679.1.11903 WP_000746679.1.11904 WP_000746679.1.11969 WP_000746679.1.12019 WP_000746679.1.12026 WP_000746679.1.12029 WP_000746679.1.12042 WP_000746679.1.1210 WP_000746679.1.1213 WP_000746679.1.12149 WP_000746679.1.12152 WP_000746679.1.12170 WP_000746679.1.12175 WP_000746679.1.12201 WP_000746679.1.12234 WP_000746679.1.12256 WP_000746679.1.12330 WP_000746679.1.12437 WP_000746679.1.12508 WP_000746679.1.12516 WP_000746679.1.1257 WP_000746679.1.12598 WP_000746679.1.12608 WP_000746679.1.12618 WP_000746679.1.12685 WP_000746679.1.12711 WP_000746679.1.12733 WP_000746679.1.12737 WP_000746679.1.1276 WP_000746679.1.12770 WP_000746679.1.12772 WP_000746679.1.12780 WP_000746679.1.12788 WP_000746679.1.12829 WP_000746679.1.12858 WP_000746679.1.12884 WP_000746679.1.12886 WP_000746679.1.12904 WP_000746679.1.12920 WP_000746679.1.13013 WP_000746679.1.13062 WP_000746679.1.13154 WP_000746679.1.13169 WP_000746679.1.13189 WP_000746679.1.13250 WP_000746679.1.13326 WP_000746679.1.13355 WP_000746679.1.13379 WP_000746679.1.13405 WP_000746679.1.13448 WP_000746679.1.13501 WP_000746679.1.13514 WP_000746679.1.13532 WP_000746679.1.13554 WP_000746679.1.13557 WP_000746679.1.13612 WP_000746679.1.13665 WP_000746679.1.13668 WP_000746679.1.13670 WP_000746679.1.13696 WP_000746679.1.13734 WP_000746679.1.1375 WP_000746679.1.13831 WP_000746679.1.13879 WP_000746679.1.13897 WP_000746679.1.13904 WP_000746679.1.13933 WP_000746679.1.13947 WP_000746679.1.13986 WP_000746679.1.13987 WP_000746679.1.14025 WP_000746679.1.14034 WP_000746679.1.14097 WP_000746679.1.14143 WP_000746679.1.14163 WP_000746679.1.14192 WP_000746679.1.1420 WP_000746679.1.14201 WP_000746679.1.1425 WP_000746679.1.1429 WP_000746679.1.14302 WP_000746679.1.14305 WP_000746679.1.14342 WP_000746679.1.14355 WP_000746679.1.14358 WP_000746679.1.14372 WP_000746679.1.14397 WP_000746679.1.14412 WP_000746679.1.14535 WP_000746679.1.14577 WP_000746679.1.14596 WP_000746679.1.14639 WP_000746679.1.14696 WP_000746679.1.1471 WP_000746679.1.14729 WP_000746679.1.14734 WP_000746679.1.14774 WP_000746679.1.14787 WP_000746679.1.14823 WP_000746679.1.14825 WP_000746679.1.14846 WP_000746679.1.14866 WP_000746679.1.14868 WP_000746679.1.14874 WP_000746679.1.14924 WP_000746679.1.14967 WP_000746679.1.14970 WP_000746679.1.15015 WP_000746679.1.15022 WP_000746679.1.15029 WP_000746679.1.15039 WP_000746679.1.15098 WP_000746679.1.15108 WP_000746679.1.15173 WP_000746679.1.15182 WP_000746679.1.15185 WP_000746679.1.1520 WP_000746679.1.15201 WP_000746679.1.15234 WP_000746679.1.1525 WP_000746679.1.15268 WP_000746679.1.15269 WP_000746679.1.15294 WP_000746679.1.15296 WP_000746679.1.15421 WP_000746679.1.15478 WP_000746679.1.15507 WP_000746679.1.15519 WP_000746679.1.15533 WP_000746679.1.15544 WP_000746679.1.15546 WP_000746679.1.15554 WP_000746679.1.1558 WP_000746679.1.15590 WP_000746679.1.1562 WP_000746679.1.1564 WP_000746679.1.15691 WP_000746679.1.15722 WP_000746679.1.15785 WP_000746679.1.15812 WP_000746679.1.159 WP_000746679.1.15920 WP_000746679.1.15921 WP_000746679.1.15925 WP_000746679.1.1599 WP_000746679.1.16018 WP_000746679.1.16068 WP_000746679.1.16095 WP_000746679.1.16096 WP_000746679.1.16098 WP_000746679.1.16114 WP_000746679.1.16140 WP_000746679.1.16173 WP_000746679.1.16195 WP_000746679.1.16203 WP_000746679.1.16223 WP_000746679.1.1623 WP_000746679.1.16251 WP_000746679.1.16265 WP_000746679.1.16276 WP_000746679.1.16283 WP_000746679.1.16311 WP_000746679.1.16395 WP_000746679.1.16407 WP_000746679.1.16433 WP_000746679.1.16458 WP_000746679.1.16589 WP_000746679.1.16606 WP_000746679.1.1662 WP_000746679.1.16632 WP_000746679.1.16639 WP_000746679.1.16649 WP_000746679.1.1665 WP_000746679.1.16651 WP_000746679.1.16653 WP_000746679.1.16664 WP_000746679.1.16684 WP_000746679.1.16693 WP_000746679.1.16747 WP_000746679.1.16761 WP_000746679.1.16762 WP_000746679.1.16794 WP_000746679.1.16815 WP_000746679.1.16824 WP_000746679.1.16833 WP_000746679.1.16880 WP_000746679.1.16882 WP_000746679.1.16920 WP_000746679.1.16925 WP_000746679.1.16938 WP_000746679.1.16969 WP_000746679.1.17046 WP_000746679.1.17080 WP_000746679.1.17122 WP_000746679.1.17132 WP_000746679.1.17139 WP_000746679.1.17157 WP_000746679.1.17180 WP_000746679.1.17193 WP_000746679.1.17200 WP_000746679.1.17240 WP_000746679.1.17248 WP_000746679.1.1729 WP_000746679.1.17309 WP_000746679.1.17327 WP_000746679.1.1736 WP_000746679.1.1741 WP_000746679.1.17419 WP_000746679.1.17454 WP_000746679.1.17475 WP_000746679.1.17526 WP_000746679.1.17529 WP_000746679.1.17531 WP_000746679.1.1756 WP_000746679.1.17590 WP_000746679.1.17628 WP_000746679.1.17643 WP_000746679.1.1765 WP_000746679.1.17651 WP_000746679.1.17658 WP_000746679.1.17671 WP_000746679.1.1771 WP_000746679.1.17717 WP_000746679.1.17718 WP_000746679.1.17720 WP_000746679.1.17725 WP_000746679.1.17737 WP_000746679.1.17796 WP_000746679.1.17818 WP_000746679.1.17832 WP_000746679.1.17835 WP_000746679.1.17838 WP_000746679.1.17847 WP_000746679.1.17853 WP_000746679.1.1787 WP_000746679.1.17882 WP_000746679.1.17909 WP_000746679.1.17922 WP_000746679.1.17943 WP_000746679.1.17966 WP_000746679.1.17987 WP_000746679.1.18011 WP_000746679.1.18069 WP_000746679.1.18080 WP_000746679.1.18113 WP_000746679.1.18140 WP_000746679.1.18153 WP_000746679.1.18203 WP_000746679.1.18237 WP_000746679.1.18248 WP_000746679.1.18261 WP_000746679.1.18288 WP_000746679.1.1829 WP_000746679.1.18301 WP_000746679.1.18309 WP_000746679.1.18310 WP_000746679.1.18360 WP_000746679.1.18412 WP_000746679.1.18429 WP_000746679.1.18466 WP_000746679.1.1847 WP_000746679.1.18487 WP_000746679.1.18497 WP_000746679.1.18504 WP_000746679.1.18506 WP_000746679.1.18507 WP_000746679.1.18539 WP_000746679.1.18545 WP_000746679.1.18560 WP_000746679.1.18566 WP_000746679.1.18570 WP_000746679.1.18591 WP_000746679.1.18632 WP_000746679.1.18679 WP_000746679.1.18741 WP_000746679.1.18763 WP_000746679.1.18774 WP_000746679.1.18777 WP_000746679.1.18779 WP_000746679.1.18792 WP_000746679.1.18818 WP_000746679.1.18819 WP_000746679.1.18834 WP_000746679.1.18882 WP_000746679.1.1892 WP_000746679.1.18965 WP_000746679.1.18974 WP_000746679.1.19052 WP_000746679.1.19082 WP_000746679.1.1911 WP_000746679.1.19301 WP_000746679.1.19322 WP_000746679.1.19365 WP_000746679.1.19386 WP_000746679.1.19430 WP_000746679.1.19450 WP_000746679.1.19455 WP_000746679.1.19497 WP_000746679.1.19515 WP_000746679.1.19555 WP_000746679.1.19577 WP_000746679.1.19611 WP_000746679.1.1964 WP_000746679.1.19643 WP_000746679.1.19653 WP_000746679.1.19701 WP_000746679.1.19717 WP_000746679.1.19725 WP_000746679.1.19732 WP_000746679.1.1974 WP_000746679.1.19748 WP_000746679.1.19792 WP_000746679.1.19801 WP_000746679.1.19816 WP_000746679.1.19848 WP_000746679.1.19891 WP_000746679.1.19905 WP_000746679.1.19912 WP_000746679.1.19921 WP_000746679.1.19968 WP_000746679.1.19980 WP_000746679.1.19981 WP_000746679.1.19982 WP_000746679.1.2 WP_000746679.1.20006 WP_000746679.1.20049 WP_000746679.1.20052 WP_000746679.1.2007 WP_000746679.1.20078 WP_000746679.1.2008 WP_000746679.1.20090 WP_000746679.1.20100 WP_000746679.1.20156 WP_000746679.1.20161 WP_000746679.1.20167 WP_000746679.1.20191 WP_000746679.1.20214 WP_000746679.1.20219 WP_000746679.1.20221 WP_000746679.1.20245 WP_000746679.1.2025 WP_000746679.1.2029 WP_000746679.1.20324 WP_000746679.1.20340 WP_000746679.1.20358 WP_000746679.1.20394 WP_000746679.1.20398 WP_000746679.1.20399 WP_000746679.1.20411 WP_000746679.1.20447 WP_000746679.1.20479 WP_000746679.1.20487 WP_000746679.1.20512 WP_000746679.1.2056 WP_000746679.1.20579 WP_000746679.1.20585 WP_000746679.1.20598 WP_000746679.1.20611 WP_000746679.1.20618 WP_000746679.1.20619 WP_000746679.1.20620 WP_000746679.1.20736 WP_000746679.1.20796 WP_000746679.1.20821 WP_000746679.1.20846 WP_000746679.1.20866 WP_000746679.1.20867 WP_000746679.1.20878 WP_000746679.1.20906 WP_000746679.1.20913 WP_000746679.1.20922 WP_000746679.1.20935 WP_000746679.1.20939 WP_000746679.1.20945 WP_000746679.1.20971 WP_000746679.1.21009 WP_000746679.1.21015 WP_000746679.1.21036 WP_000746679.1.21056 WP_000746679.1.21066 WP_000746679.1.21078 WP_000746679.1.21109 WP_000746679.1.21111 WP_000746679.1.21140 WP_000746679.1.21154 WP_000746679.1.21183 WP_000746679.1.2119 WP_000746679.1.21222 WP_000746679.1.21257 WP_000746679.1.21259 WP_000746679.1.21272 WP_000746679.1.21313 WP_000746679.1.21314 WP_000746679.1.21339 WP_000746679.1.2135 WP_000746679.1.21359 WP_000746679.1.21375 WP_000746679.1.21379 WP_000746679.1.21393 WP_000746679.1.21412 WP_000746679.1.21416 WP_000746679.1.21449 WP_000746679.1.21464 WP_000746679.1.21480 WP_000746679.1.21500 WP_000746679.1.21505 WP_000746679.1.21514 WP_000746679.1.21572 WP_000746679.1.21589 WP_000746679.1.2159 WP_000746679.1.2160 WP_000746679.1.21636 WP_000746679.1.21719 WP_000746679.1.21724 WP_000746679.1.21746 WP_000746679.1.21763 WP_000746679.1.2178 WP_000746679.1.21787 WP_000746679.1.21830 WP_000746679.1.21900 WP_000746679.1.21985 WP_000746679.1.21988 WP_000746679.1.2200 WP_000746679.1.22000 WP_000746679.1.22011 WP_000746679.1.22027 WP_000746679.1.22033 WP_000746679.1.22038 WP_000746679.1.22049 WP_000746679.1.22082 WP_000746679.1.22111 WP_000746679.1.22164 WP_000746679.1.22177 WP_000746679.1.22180 WP_000746679.1.22197 WP_000746679.1.22227 WP_000746679.1.22302 WP_000746679.1.22400 WP_000746679.1.22419 WP_000746679.1.22426 WP_000746679.1.22441 WP_000746679.1.22493 WP_000746679.1.22498 WP_000746679.1.22533 WP_000746679.1.22559 WP_000746679.1.22650 WP_000746679.1.22696 WP_000746679.1.22702 WP_000746679.1.22709 WP_000746679.1.22738 WP_000746679.1.22764 WP_000746679.1.22789 WP_000746679.1.22790 WP_000746679.1.22792 WP_000746679.1.22803 WP_000746679.1.22826 WP_000746679.1.22853 WP_000746679.1.22869 WP_000746679.1.22890 WP_000746679.1.22924 WP_000746679.1.22969 WP_000746679.1.22983 WP_000746679.1.22984 WP_000746679.1.23008 WP_000746679.1.23012 WP_000746679.1.23061 WP_000746679.1.23082 WP_000746679.1.23103 WP_000746679.1.23121 WP_000746679.1.23130 WP_000746679.1.23132 WP_000746679.1.23133 WP_000746679.1.23146 WP_000746679.1.23161 WP_000746679.1.23185 WP_000746679.1.23197 WP_000746679.1.23244 WP_000746679.1.23251 WP_000746679.1.2327 WP_000746679.1.23275 WP_000746679.1.23288 WP_000746679.1.23304 WP_000746679.1.23413 WP_000746679.1.23449 WP_000746679.1.23476 WP_000746679.1.23517 WP_000746679.1.23531 WP_000746679.1.23572 WP_000746679.1.23630 WP_000746679.1.23644 WP_000746679.1.23671 WP_000746679.1.23690 WP_000746679.1.23708 WP_000746679.1.23730 WP_000746679.1.23740 WP_000746679.1.23796 WP_000746679.1.23809 WP_000746679.1.23842 WP_000746679.1.2389 WP_000746679.1.23900 WP_000746679.1.23926 WP_000746679.1.23956 WP_000746679.1.23972 WP_000746679.1.23995 WP_000746679.1.24000 WP_000746679.1.24081 WP_000746679.1.24129 WP_000746679.1.24154 WP_000746679.1.24207 WP_000746679.1.24213 WP_000746679.1.24226 WP_000746679.1.24263 WP_000746679.1.2427 WP_000746679.1.24276 WP_000746679.1.24277 WP_000746679.1.24286 WP_000746679.1.24302 WP_000746679.1.24343 WP_000746679.1.24365 WP_000746679.1.24416 WP_000746679.1.24437 WP_000746679.1.24469 WP_000746679.1.2450 WP_000746679.1.24516 WP_000746679.1.24569 WP_000746679.1.24572 WP_000746679.1.24589 WP_000746679.1.24596 WP_000746679.1.24602 WP_000746679.1.24625 WP_000746679.1.24631 WP_000746679.1.24654 WP_000746679.1.24674 WP_000746679.1.24679 WP_000746679.1.24685 WP_000746679.1.24711 WP_000746679.1.24714 WP_000746679.1.24823 WP_000746679.1.24834 WP_000746679.1.24855 WP_000746679.1.24937 WP_000746679.1.2497 WP_000746679.1.24996 WP_000746679.1.25001 WP_000746679.1.25007 WP_000746679.1.2501 WP_000746679.1.25012 WP_000746679.1.2506 WP_000746679.1.25070 WP_000746679.1.25092 WP_000746679.1.25098 WP_000746679.1.25115 WP_000746679.1.25145 WP_000746679.1.25167 WP_000746679.1.25209 WP_000746679.1.25216 WP_000746679.1.25221 WP_000746679.1.25262 WP_000746679.1.25287 WP_000746679.1.25288 WP_000746679.1.25331 WP_000746679.1.25341 WP_000746679.1.25345 WP_000746679.1.25361 WP_000746679.1.25459 WP_000746679.1.25489 WP_000746679.1.2552 WP_000746679.1.25557 WP_000746679.1.25569 WP_000746679.1.25595 WP_000746679.1.25621 WP_000746679.1.25623 WP_000746679.1.25651 WP_000746679.1.25721 WP_000746679.1.25732 WP_000746679.1.25758 WP_000746679.1.25772 WP_000746679.1.25779 WP_000746679.1.25802 WP_000746679.1.25840 WP_000746679.1.25856 WP_000746679.1.25857 WP_000746679.1.2590 WP_000746679.1.25910 WP_000746679.1.2592 WP_000746679.1.25929 WP_000746679.1.25930 WP_000746679.1.26039 WP_000746679.1.26050 WP_000746679.1.26058 WP_000746679.1.2608 WP_000746679.1.26086 WP_000746679.1.26094 WP_000746679.1.26106 WP_000746679.1.26143 WP_000746679.1.26169 WP_000746679.1.2621 WP_000746679.1.26225 WP_000746679.1.26226 WP_000746679.1.26255 WP_000746679.1.26266 WP_000746679.1.26271 WP_000746679.1.26276 WP_000746679.1.26283 WP_000746679.1.26290 WP_000746679.1.26298 WP_000746679.1.26314 WP_000746679.1.26318 WP_000746679.1.26340 WP_000746679.1.26345 WP_000746679.1.26354 WP_000746679.1.26359 WP_000746679.1.26364 WP_000746679.1.26399 WP_000746679.1.26404 WP_000746679.1.2643 WP_000746679.1.26431 WP_000746679.1.26506 WP_000746679.1.26533 WP_000746679.1.26662 WP_000746679.1.26664 WP_000746679.1.26677 WP_000746679.1.26692 WP_000746679.1.2673 WP_000746679.1.26751 WP_000746679.1.26773 WP_000746679.1.26778 WP_000746679.1.2680 WP_000746679.1.26804 WP_000746679.1.2684 WP_000746679.1.26840 WP_000746679.1.26864 WP_000746679.1.26865 WP_000746679.1.26884 WP_000746679.1.2689 WP_000746679.1.26903 WP_000746679.1.26905 WP_000746679.1.26938 WP_000746679.1.26944 WP_000746679.1.26947 WP_000746679.1.27013 WP_000746679.1.27053 WP_000746679.1.27083 WP_000746679.1.2710 WP_000746679.1.27147 WP_000746679.1.27160 WP_000746679.1.27166 WP_000746679.1.27170 WP_000746679.1.27182 WP_000746679.1.2719 WP_000746679.1.27226 WP_000746679.1.2725 WP_000746679.1.27262 WP_000746679.1.27293 WP_000746679.1.27294 WP_000746679.1.27303 WP_000746679.1.27323 WP_000746679.1.27379 WP_000746679.1.27384 WP_000746679.1.27387 WP_000746679.1.27413 WP_000746679.1.2744 WP_000746679.1.27447 WP_000746679.1.27456 WP_000746679.1.27468 WP_000746679.1.27489 WP_000746679.1.27529 WP_000746679.1.2753 WP_000746679.1.27539 WP_000746679.1.27590 WP_000746679.1.27605 WP_000746679.1.27628 WP_000746679.1.27646 WP_000746679.1.27689 WP_000746679.1.27720 WP_000746679.1.27739 WP_000746679.1.27744 WP_000746679.1.27765 WP_000746679.1.27793 WP_000746679.1.27830 WP_000746679.1.2795 WP_000746679.1.2800 WP_000746679.1.28016 WP_000746679.1.28074 WP_000746679.1.2808 WP_000746679.1.28091 WP_000746679.1.28105 WP_000746679.1.28107 WP_000746679.1.28173 WP_000746679.1.28213 WP_000746679.1.28226 WP_000746679.1.28230 WP_000746679.1.28253 WP_000746679.1.28257 WP_000746679.1.28274 WP_000746679.1.28315 WP_000746679.1.28319 WP_000746679.1.28336 WP_000746679.1.28337 WP_000746679.1.28347 WP_000746679.1.28392 WP_000746679.1.28394 WP_000746679.1.2840 WP_000746679.1.28400 WP_000746679.1.28430 WP_000746679.1.28490 WP_000746679.1.2852 WP_000746679.1.28578 WP_000746679.1.28580 WP_000746679.1.28605 WP_000746679.1.28636 WP_000746679.1.28652 WP_000746679.1.28720 WP_000746679.1.28763 WP_000746679.1.28784 WP_000746679.1.28785 WP_000746679.1.28825 WP_000746679.1.28833 WP_000746679.1.28848 WP_000746679.1.28871 WP_000746679.1.28909 WP_000746679.1.28981 WP_000746679.1.28987 WP_000746679.1.29014 WP_000746679.1.29052 WP_000746679.1.2906 WP_000746679.1.29060 WP_000746679.1.29091 WP_000746679.1.29110 WP_000746679.1.29112 WP_000746679.1.29155 WP_000746679.1.29166 WP_000746679.1.29187 WP_000746679.1.29226 WP_000746679.1.29242 WP_000746679.1.29263 WP_000746679.1.29276 WP_000746679.1.29329 WP_000746679.1.29340 WP_000746679.1.29366 WP_000746679.1.29368 WP_000746679.1.29375 WP_000746679.1.29395 WP_000746679.1.29420 WP_000746679.1.29433 WP_000746679.1.29453 WP_000746679.1.29468 WP_000746679.1.29479 WP_000746679.1.29483 WP_000746679.1.29484 WP_000746679.1.29522 WP_000746679.1.29554 WP_000746679.1.2957 WP_000746679.1.29571 WP_000746679.1.29692 WP_000746679.1.29709 WP_000746679.1.29710 WP_000746679.1.2972 WP_000746679.1.29736 WP_000746679.1.29744 WP_000746679.1.29788 WP_000746679.1.2981 WP_000746679.1.29862 WP_000746679.1.29902 WP_000746679.1.29905 WP_000746679.1.29918 WP_000746679.1.29956 WP_000746679.1.29981 WP_000746679.1.30051 WP_000746679.1.30089 WP_000746679.1.30095 WP_000746679.1.30100 WP_000746679.1.30115 WP_000746679.1.3012 WP_000746679.1.30152 WP_000746679.1.30159 WP_000746679.1.30169 WP_000746679.1.30197 WP_000746679.1.30203 WP_000746679.1.30204 WP_000746679.1.30209 WP_000746679.1.30230 WP_000746679.1.30249 WP_000746679.1.30268 WP_000746679.1.30302 WP_000746679.1.30307 WP_000746679.1.30328 WP_000746679.1.30364 WP_000746679.1.30392 WP_000746679.1.30482 WP_000746679.1.3050 WP_000746679.1.30508 WP_000746679.1.30531 WP_000746679.1.30560 WP_000746679.1.30600 WP_000746679.1.30622 WP_000746679.1.30645 WP_000746679.1.30646 WP_000746679.1.30666 WP_000746679.1.30668 WP_000746679.1.30702 WP_000746679.1.30720 WP_000746679.1.30726 WP_000746679.1.30763 WP_000746679.1.3077 WP_000746679.1.30845 WP_000746679.1.30847 WP_000746679.1.30854 WP_000746679.1.30962 WP_000746679.1.31005 WP_000746679.1.31022 WP_000746679.1.31039 WP_000746679.1.31048 WP_000746679.1.31091 WP_000746679.1.31123 WP_000746679.1.31176 WP_000746679.1.31206 WP_000746679.1.3123 WP_000746679.1.31294 WP_000746679.1.31315 WP_000746679.1.31337 WP_000746679.1.31339 WP_000746679.1.31355 WP_000746679.1.31402 WP_000746679.1.31424 WP_000746679.1.31437 WP_000746679.1.31442 WP_000746679.1.31468 WP_000746679.1.31479 WP_000746679.1.31484 WP_000746679.1.31529 WP_000746679.1.31531 WP_000746679.1.31539 WP_000746679.1.31642 WP_000746679.1.31647 WP_000746679.1.31653 WP_000746679.1.31686 WP_000746679.1.31753 WP_000746679.1.31791 WP_000746679.1.31806 WP_000746679.1.31827 WP_000746679.1.31828 WP_000746679.1.31842 WP_000746679.1.31892 WP_000746679.1.31931 WP_000746679.1.31997 WP_000746679.1.32003 WP_000746679.1.32005 WP_000746679.1.32029 WP_000746679.1.32067 WP_000746679.1.32160 WP_000746679.1.3219 WP_000746679.1.32207 WP_000746679.1.32270 WP_000746679.1.3229 WP_000746679.1.32325 WP_000746679.1.32338 WP_000746679.1.32339 WP_000746679.1.32340 WP_000746679.1.3242 WP_000746679.1.32474 WP_000746679.1.32481 WP_000746679.1.32483 WP_000746679.1.32514 WP_000746679.1.32534 WP_000746679.1.32565 WP_000746679.1.32607 WP_000746679.1.32634 WP_000746679.1.32636 WP_000746679.1.32645 WP_000746679.1.32671 WP_000746679.1.32746 WP_000746679.1.32754 WP_000746679.1.32764 WP_000746679.1.32770 WP_000746679.1.32795 WP_000746679.1.328 WP_000746679.1.32800 WP_000746679.1.32925 WP_000746679.1.32928 WP_000746679.1.32939 WP_000746679.1.32954 WP_000746679.1.32965 WP_000746679.1.32980 WP_000746679.1.3301 WP_000746679.1.33038 WP_000746679.1.33048 WP_000746679.1.33110 WP_000746679.1.33123 WP_000746679.1.33138 WP_000746679.1.33161 WP_000746679.1.33199 WP_000746679.1.33212 WP_000746679.1.33250 WP_000746679.1.33266 WP_000746679.1.33296 WP_000746679.1.33335 WP_000746679.1.33357 WP_000746679.1.33368 WP_000746679.1.33416 WP_000746679.1.3342 WP_000746679.1.33432 WP_000746679.1.33468 WP_000746679.1.3347 WP_000746679.1.33507 WP_000746679.1.33516 WP_000746679.1.33518 WP_000746679.1.33540 WP_000746679.1.3357 WP_000746679.1.33594 WP_000746679.1.33626 WP_000746679.1.33627 WP_000746679.1.3363 WP_000746679.1.33654 WP_000746679.1.33692 WP_000746679.1.33695 WP_000746679.1.33718 WP_000746679.1.33720 WP_000746679.1.33735 WP_000746679.1.33743 WP_000746679.1.33769 WP_000746679.1.33792 WP_000746679.1.33804 WP_000746679.1.33813 WP_000746679.1.33855 WP_000746679.1.33915 WP_000746679.1.33968 WP_000746679.1.33971 WP_000746679.1.33983 WP_000746679.1.34026 WP_000746679.1.34030 WP_000746679.1.34051 WP_000746679.1.34062 WP_000746679.1.34079 WP_000746679.1.34100 WP_000746679.1.34128 WP_000746679.1.34132 WP_000746679.1.34168 WP_000746679.1.34182 WP_000746679.1.34209 WP_000746679.1.3422 WP_000746679.1.34231 WP_000746679.1.34244 WP_000746679.1.34250 WP_000746679.1.34251 WP_000746679.1.34285 WP_000746679.1.34381 WP_000746679.1.34403 WP_000746679.1.34410 WP_000746679.1.34482 WP_000746679.1.34492 WP_000746679.1.34502 WP_000746679.1.34510 WP_000746679.1.34526 WP_000746679.1.34531 WP_000746679.1.3461 WP_000746679.1.34620 WP_000746679.1.34626 WP_000746679.1.34666 WP_000746679.1.34677 WP_000746679.1.34737 WP_000746679.1.34767 WP_000746679.1.34818 WP_000746679.1.34890 WP_000746679.1.34918 WP_000746679.1.34998 WP_000746679.1.35059 WP_000746679.1.35062 WP_000746679.1.35089 WP_000746679.1.35097 WP_000746679.1.35106 WP_000746679.1.35108 WP_000746679.1.35110 WP_000746679.1.35121 WP_000746679.1.35177 WP_000746679.1.35189 WP_000746679.1.35222 WP_000746679.1.35233 WP_000746679.1.35257 WP_000746679.1.35276 WP_000746679.1.35285 WP_000746679.1.35297 WP_000746679.1.35334 WP_000746679.1.35342 WP_000746679.1.35352 WP_000746679.1.354 WP_000746679.1.35415 WP_000746679.1.3547 WP_000746679.1.35490 WP_000746679.1.35497 WP_000746679.1.35498 WP_000746679.1.3552 WP_000746679.1.35525 WP_000746679.1.35580 WP_000746679.1.35615 WP_000746679.1.35623 WP_000746679.1.35643 WP_000746679.1.35673 WP_000746679.1.3569 WP_000746679.1.35774 WP_000746679.1.35794 WP_000746679.1.35799 WP_000746679.1.35801 WP_000746679.1.35826 WP_000746679.1.35900 WP_000746679.1.35928 WP_000746679.1.35950 WP_000746679.1.36004 WP_000746679.1.36021 WP_000746679.1.36082 WP_000746679.1.36102 WP_000746679.1.36117 WP_000746679.1.36119 WP_000746679.1.36141 WP_000746679.1.3617 WP_000746679.1.36175 WP_000746679.1.36176 WP_000746679.1.36187 WP_000746679.1.36188 WP_000746679.1.36193 WP_000746679.1.36220 WP_000746679.1.3623 WP_000746679.1.36250 WP_000746679.1.36264 WP_000746679.1.36278 WP_000746679.1.36282 WP_000746679.1.36283 WP_000746679.1.36307 WP_000746679.1.36325 WP_000746679.1.36344 WP_000746679.1.36389 WP_000746679.1.36522 WP_000746679.1.36532 WP_000746679.1.36535 WP_000746679.1.3655 WP_000746679.1.36551 WP_000746679.1.36570 WP_000746679.1.36580 WP_000746679.1.36600 WP_000746679.1.36604 WP_000746679.1.36615 WP_000746679.1.36646 WP_000746679.1.3666 WP_000746679.1.36689 WP_000746679.1.36697 WP_000746679.1.36745 WP_000746679.1.3675 WP_000746679.1.36770 WP_000746679.1.36783 WP_000746679.1.36793 WP_000746679.1.36796 WP_000746679.1.36809 WP_000746679.1.36822 WP_000746679.1.3685 WP_000746679.1.36858 WP_000746679.1.3687 WP_000746679.1.36884 WP_000746679.1.36955 WP_000746679.1.36979 WP_000746679.1.36980 WP_000746679.1.36997 WP_000746679.1.37002 WP_000746679.1.37016 WP_000746679.1.3703 WP_000746679.1.37044 WP_000746679.1.37055 WP_000746679.1.37080 WP_000746679.1.37121 WP_000746679.1.37132 WP_000746679.1.37134 WP_000746679.1.37220 WP_000746679.1.37304 WP_000746679.1.37341 WP_000746679.1.37354 WP_000746679.1.37398 WP_000746679.1.37424 WP_000746679.1.37467 WP_000746679.1.37536 WP_000746679.1.37563 WP_000746679.1.37583 WP_000746679.1.37602 WP_000746679.1.37605 WP_000746679.1.37606 WP_000746679.1.37621 WP_000746679.1.37624 WP_000746679.1.37636 WP_000746679.1.37652 WP_000746679.1.37781 WP_000746679.1.37795 WP_000746679.1.37815 WP_000746679.1.37828 WP_000746679.1.37953 WP_000746679.1.37987 WP_000746679.1.38007 WP_000746679.1.38038 WP_000746679.1.38057 WP_000746679.1.38070 WP_000746679.1.38082 WP_000746679.1.3809 WP_000746679.1.38160 WP_000746679.1.38177 WP_000746679.1.3820 WP_000746679.1.38230 WP_000746679.1.38232 WP_000746679.1.3827 WP_000746679.1.38276 WP_000746679.1.38282 WP_000746679.1.38309 WP_000746679.1.38311 WP_000746679.1.38330 WP_000746679.1.38336 WP_000746679.1.38339 WP_000746679.1.38346 WP_000746679.1.38383 WP_000746679.1.3842 WP_000746679.1.38437 WP_000746679.1.38453 WP_000746679.1.38489 WP_000746679.1.38493 WP_000746679.1.3852 WP_000746679.1.38522 WP_000746679.1.38546 WP_000746679.1.38551 WP_000746679.1.38600 WP_000746679.1.38607 WP_000746679.1.38612 WP_000746679.1.3867 WP_000746679.1.38674 WP_000746679.1.38721 WP_000746679.1.38760 WP_000746679.1.38823 WP_000746679.1.38841 WP_000746679.1.38858 WP_000746679.1.38926 WP_000746679.1.38931 WP_000746679.1.3894 WP_000746679.1.38940 WP_000746679.1.38941 WP_000746679.1.38972 WP_000746679.1.38989 WP_000746679.1.390 WP_000746679.1.39012 WP_000746679.1.39014 WP_000746679.1.39043 WP_000746679.1.39053 WP_000746679.1.3906 WP_000746679.1.391 WP_000746679.1.39108 WP_000746679.1.39117 WP_000746679.1.39203 WP_000746679.1.39206 WP_000746679.1.39217 WP_000746679.1.3926 WP_000746679.1.39272 WP_000746679.1.39281 WP_000746679.1.39290 WP_000746679.1.39332 WP_000746679.1.39333 WP_000746679.1.39368 WP_000746679.1.39397 WP_000746679.1.39406 WP_000746679.1.39486 WP_000746679.1.39506 WP_000746679.1.39550 WP_000746679.1.39625 WP_000746679.1.39645 WP_000746679.1.39662 WP_000746679.1.39687 WP_000746679.1.39689 WP_000746679.1.39697 WP_000746679.1.39711 WP_000746679.1.39738 WP_000746679.1.39767 WP_000746679.1.39773 WP_000746679.1.39789 WP_000746679.1.39812 WP_000746679.1.39832 WP_000746679.1.39834 WP_000746679.1.39838 WP_000746679.1.39856 WP_000746679.1.39869 WP_000746679.1.39875 WP_000746679.1.39880 WP_000746679.1.40014 WP_000746679.1.40043 WP_000746679.1.40053 WP_000746679.1.4006 WP_000746679.1.40085 WP_000746679.1.40099 WP_000746679.1.4012 WP_000746679.1.40120 WP_000746679.1.40130 WP_000746679.1.40137 WP_000746679.1.4015 WP_000746679.1.40164 WP_000746679.1.40173 WP_000746679.1.4019 WP_000746679.1.40220 WP_000746679.1.4025 WP_000746679.1.40316 WP_000746679.1.40318 WP_000746679.1.40320 WP_000746679.1.40322 WP_000746679.1.40330 WP_000746679.1.40340 WP_000746679.1.40342 WP_000746679.1.40368 WP_000746679.1.40406 WP_000746679.1.40435 WP_000746679.1.4045 WP_000746679.1.40474 WP_000746679.1.40481 WP_000746679.1.40505 WP_000746679.1.40531 WP_000746679.1.40532 WP_000746679.1.4056 WP_000746679.1.4057 WP_000746679.1.40579 WP_000746679.1.40588 WP_000746679.1.40620 WP_000746679.1.40644 WP_000746679.1.40655 WP_000746679.1.40658 WP_000746679.1.40659 WP_000746679.1.40760 WP_000746679.1.40797 WP_000746679.1.40816 WP_000746679.1.40954 WP_000746679.1.41064 WP_000746679.1.41084 WP_000746679.1.41094 WP_000746679.1.41109 WP_000746679.1.41119 WP_000746679.1.41129 WP_000746679.1.4115 WP_000746679.1.41178 WP_000746679.1.41208 WP_000746679.1.41238 WP_000746679.1.41241 WP_000746679.1.41245 WP_000746679.1.41255 WP_000746679.1.41288 WP_000746679.1.41289 WP_000746679.1.4129 WP_000746679.1.41314 WP_000746679.1.4138 WP_000746679.1.41426 WP_000746679.1.41432 WP_000746679.1.41433 WP_000746679.1.41444 WP_000746679.1.41461 WP_000746679.1.41499 WP_000746679.1.41558 WP_000746679.1.41567 WP_000746679.1.41582 WP_000746679.1.41599 WP_000746679.1.4160 WP_000746679.1.4162 WP_000746679.1.41647 WP_000746679.1.41674 WP_000746679.1.41839 WP_000746679.1.4188 WP_000746679.1.41898 WP_000746679.1.41906 WP_000746679.1.41935 WP_000746679.1.41943 WP_000746679.1.41989 WP_000746679.1.420 WP_000746679.1.42005 WP_000746679.1.42015 WP_000746679.1.42017 WP_000746679.1.42028 WP_000746679.1.42087 WP_000746679.1.42125 WP_000746679.1.42137 WP_000746679.1.42177 WP_000746679.1.42198 WP_000746679.1.42269 WP_000746679.1.42305 WP_000746679.1.4231 WP_000746679.1.42355 WP_000746679.1.42403 WP_000746679.1.42436 WP_000746679.1.42438 WP_000746679.1.42455 WP_000746679.1.42459 WP_000746679.1.42481 WP_000746679.1.42503 WP_000746679.1.42510 WP_000746679.1.42517 WP_000746679.1.42593 WP_000746679.1.42598 WP_000746679.1.426 WP_000746679.1.4260 WP_000746679.1.42640 WP_000746679.1.42652 WP_000746679.1.42668 WP_000746679.1.42674 WP_000746679.1.42679 WP_000746679.1.42706 WP_000746679.1.42737 WP_000746679.1.42759 WP_000746679.1.42786 WP_000746679.1.42802 WP_000746679.1.42837 WP_000746679.1.42883 WP_000746679.1.42893 WP_000746679.1.4293 WP_000746679.1.42982 WP_000746679.1.4299 WP_000746679.1.43014 WP_000746679.1.43033 WP_000746679.1.43047 WP_000746679.1.43072 WP_000746679.1.43122 WP_000746679.1.43131 WP_000746679.1.43134 WP_000746679.1.43143 WP_000746679.1.43147 WP_000746679.1.43159 WP_000746679.1.43165 WP_000746679.1.43202 WP_000746679.1.43232 WP_000746679.1.43248 WP_000746679.1.4325 WP_000746679.1.43263 WP_000746679.1.4327 WP_000746679.1.43274 WP_000746679.1.43323 WP_000746679.1.43325 WP_000746679.1.43328 WP_000746679.1.43341 WP_000746679.1.43349 WP_000746679.1.43366 WP_000746679.1.43369 WP_000746679.1.4337 WP_000746679.1.43406 WP_000746679.1.4341 WP_000746679.1.43414 WP_000746679.1.43460 WP_000746679.1.4347 WP_000746679.1.43550 WP_000746679.1.43560 WP_000746679.1.43600 WP_000746679.1.43617 WP_000746679.1.43618 WP_000746679.1.43627 WP_000746679.1.43659 WP_000746679.1.43670 WP_000746679.1.4370 WP_000746679.1.43702 WP_000746679.1.4372 WP_000746679.1.43731 WP_000746679.1.4374 WP_000746679.1.43752 WP_000746679.1.43788 WP_000746679.1.43819 WP_000746679.1.43822 WP_000746679.1.43827 WP_000746679.1.4385 WP_000746679.1.43904 WP_000746679.1.43915 WP_000746679.1.43924 WP_000746679.1.43984 WP_000746679.1.44072 WP_000746679.1.44119 WP_000746679.1.44153 WP_000746679.1.44181 WP_000746679.1.44195 WP_000746679.1.44265 WP_000746679.1.44302 WP_000746679.1.44312 WP_000746679.1.44388 WP_000746679.1.44396 WP_000746679.1.44405 WP_000746679.1.44420 WP_000746679.1.44455 WP_000746679.1.44493 WP_000746679.1.44544 WP_000746679.1.44579 WP_000746679.1.44588 WP_000746679.1.44605 WP_000746679.1.44631 WP_000746679.1.44672 WP_000746679.1.44674 WP_000746679.1.44732 WP_000746679.1.44755 WP_000746679.1.44768 WP_000746679.1.44785 WP_000746679.1.44788 WP_000746679.1.44796 WP_000746679.1.44802 WP_000746679.1.44853 WP_000746679.1.44881 WP_000746679.1.44882 WP_000746679.1.44891 WP_000746679.1.44914 WP_000746679.1.44932 WP_000746679.1.44969 WP_000746679.1.45015 WP_000746679.1.45033 WP_000746679.1.45035 WP_000746679.1.45099 WP_000746679.1.45111 WP_000746679.1.4513 WP_000746679.1.45133 WP_000746679.1.45164 WP_000746679.1.45170 WP_000746679.1.45188 WP_000746679.1.45189 WP_000746679.1.45272 WP_000746679.1.45290 WP_000746679.1.45297 WP_000746679.1.453 WP_000746679.1.45321 WP_000746679.1.45332 WP_000746679.1.45364 WP_000746679.1.45431 WP_000746679.1.45439 WP_000746679.1.45472 WP_000746679.1.4550 WP_000746679.1.45507 WP_000746679.1.45560 WP_000746679.1.45577 WP_000746679.1.45640 WP_000746679.1.45654 WP_000746679.1.45670 WP_000746679.1.45703 WP_000746679.1.45713 WP_000746679.1.45730 WP_000746679.1.45747 WP_000746679.1.45768 WP_000746679.1.45771 WP_000746679.1.45780 WP_000746679.1.4580 WP_000746679.1.4584 WP_000746679.1.45852 WP_000746679.1.45870 WP_000746679.1.45875 WP_000746679.1.45881 WP_000746679.1.45888 WP_000746679.1.45897 WP_000746679.1.459 WP_000746679.1.45954 WP_000746679.1.4598 WP_000746679.1.46003 WP_000746679.1.46005 WP_000746679.1.46055 WP_000746679.1.46071 WP_000746679.1.46087 WP_000746679.1.46106 WP_000746679.1.46136 WP_000746679.1.46168 WP_000746679.1.46208 WP_000746679.1.46212 WP_000746679.1.46222 WP_000746679.1.46228 WP_000746679.1.46276 WP_000746679.1.46320 WP_000746679.1.46330 WP_000746679.1.46334 WP_000746679.1.46362 WP_000746679.1.46368 WP_000746679.1.46380 WP_000746679.1.46401 WP_000746679.1.46422 WP_000746679.1.46457 WP_000746679.1.46465 WP_000746679.1.46528 WP_000746679.1.46534 WP_000746679.1.46543 WP_000746679.1.4662 WP_000746679.1.46660 WP_000746679.1.46664 WP_000746679.1.46670 WP_000746679.1.46688 WP_000746679.1.46692 WP_000746679.1.46702 WP_000746679.1.46703 WP_000746679.1.46752 WP_000746679.1.46765 WP_000746679.1.46767 WP_000746679.1.46772 WP_000746679.1.46823 WP_000746679.1.46837 WP_000746679.1.46852 WP_000746679.1.46875 WP_000746679.1.46881 WP_000746679.1.46908 WP_000746679.1.46911 WP_000746679.1.46925 WP_000746679.1.46937 WP_000746679.1.4696 WP_000746679.1.46964 WP_000746679.1.46983 WP_000746679.1.46995 WP_000746679.1.47051 WP_000746679.1.47128 WP_000746679.1.47153 WP_000746679.1.47159 WP_000746679.1.4716 WP_000746679.1.47163 WP_000746679.1.47187 WP_000746679.1.47205 WP_000746679.1.47211 WP_000746679.1.47216 WP_000746679.1.47218 WP_000746679.1.47258 WP_000746679.1.47269 WP_000746679.1.47279 WP_000746679.1.4728 WP_000746679.1.47290 WP_000746679.1.47294 WP_000746679.1.47306 WP_000746679.1.47317 WP_000746679.1.47328 WP_000746679.1.47381 WP_000746679.1.47383 WP_000746679.1.47399 WP_000746679.1.47405 WP_000746679.1.47406 WP_000746679.1.47422 WP_000746679.1.47426 WP_000746679.1.47432 WP_000746679.1.47439 WP_000746679.1.47450 WP_000746679.1.4752 WP_000746679.1.47560 WP_000746679.1.47570 WP_000746679.1.47577 WP_000746679.1.47618 WP_000746679.1.4767 WP_000746679.1.477 WP_000746679.1.47733 WP_000746679.1.47763 WP_000746679.1.47782 WP_000746679.1.47821 WP_000746679.1.47836 WP_000746679.1.47859 WP_000746679.1.47872 WP_000746679.1.47873 WP_000746679.1.47901 WP_000746679.1.47904 WP_000746679.1.47951 WP_000746679.1.47980 WP_000746679.1.47996 WP_000746679.1.48009 WP_000746679.1.48011 WP_000746679.1.48030 WP_000746679.1.48047 WP_000746679.1.4805 WP_000746679.1.48149 WP_000746679.1.4815 WP_000746679.1.48154 WP_000746679.1.48169 WP_000746679.1.48186 WP_000746679.1.48197 WP_000746679.1.48205 WP_000746679.1.48227 WP_000746679.1.48236 WP_000746679.1.48250 WP_000746679.1.48284 WP_000746679.1.48293 WP_000746679.1.48307 WP_000746679.1.48322 WP_000746679.1.48326 WP_000746679.1.48364 WP_000746679.1.48391 WP_000746679.1.48394 WP_000746679.1.484 WP_000746679.1.48463 WP_000746679.1.48492 WP_000746679.1.48563 WP_000746679.1.48577 WP_000746679.1.48593 WP_000746679.1.48634 WP_000746679.1.48656 WP_000746679.1.4868 WP_000746679.1.48694 WP_000746679.1.48705 WP_000746679.1.48711 WP_000746679.1.48786 WP_000746679.1.48805 WP_000746679.1.48823 WP_000746679.1.48833 WP_000746679.1.48835 WP_000746679.1.4886 WP_000746679.1.48936 WP_000746679.1.48941 WP_000746679.1.48945 WP_000746679.1.48951 WP_000746679.1.48968 WP_000746679.1.48982 WP_000746679.1.48993 WP_000746679.1.4901 WP_000746679.1.4905 WP_000746679.1.49129 WP_000746679.1.49150 WP_000746679.1.49159 WP_000746679.1.4916 WP_000746679.1.49161 WP_000746679.1.4917 WP_000746679.1.4918 WP_000746679.1.49207 WP_000746679.1.4921 WP_000746679.1.49248 WP_000746679.1.49327 WP_000746679.1.49398 WP_000746679.1.49484 WP_000746679.1.4950 WP_000746679.1.49573 WP_000746679.1.49605 WP_000746679.1.4962 WP_000746679.1.49653 WP_000746679.1.49658 WP_000746679.1.49669 WP_000746679.1.49671 WP_000746679.1.49707 WP_000746679.1.49730 WP_000746679.1.49742 WP_000746679.1.49757 WP_000746679.1.4980 WP_000746679.1.49800 WP_000746679.1.49860 WP_000746679.1.49863 WP_000746679.1.4987 WP_000746679.1.49871 WP_000746679.1.4989 WP_000746679.1.49894 WP_000746679.1.49907 WP_000746679.1.49917 WP_000746679.1.49934 WP_000746679.1.4994 WP_000746679.1.49943 WP_000746679.1.49951 WP_000746679.1.49970 WP_000746679.1.49982 WP_000746679.1.50013 WP_000746679.1.50023 WP_000746679.1.50038 WP_000746679.1.50039 WP_000746679.1.50061 WP_000746679.1.50064 WP_000746679.1.50076 WP_000746679.1.5013 WP_000746679.1.50138 WP_000746679.1.50175 WP_000746679.1.50212 WP_000746679.1.50217 WP_000746679.1.50219 WP_000746679.1.50261 WP_000746679.1.50313 WP_000746679.1.50314 WP_000746679.1.5035 WP_000746679.1.50356 WP_000746679.1.50424 WP_000746679.1.50425 WP_000746679.1.50440 WP_000746679.1.50527 WP_000746679.1.50536 WP_000746679.1.50543 WP_000746679.1.50555 WP_000746679.1.50578 WP_000746679.1.50595 WP_000746679.1.50660 WP_000746679.1.50732 WP_000746679.1.50742 WP_000746679.1.50748 WP_000746679.1.50768 WP_000746679.1.50799 WP_000746679.1.50820 WP_000746679.1.50884 WP_000746679.1.50896 WP_000746679.1.50937 WP_000746679.1.50958 WP_000746679.1.50962 WP_000746679.1.5109 WP_000746679.1.5110 WP_000746679.1.5111 WP_000746679.1.51152 WP_000746679.1.5117 WP_000746679.1.51194 WP_000746679.1.51236 WP_000746679.1.51245 WP_000746679.1.51250 WP_000746679.1.51282 WP_000746679.1.51295 WP_000746679.1.51306 WP_000746679.1.51310 WP_000746679.1.51346 WP_000746679.1.51376 WP_000746679.1.51377 WP_000746679.1.51403 WP_000746679.1.51418 WP_000746679.1.5145 WP_000746679.1.51454 WP_000746679.1.51456 WP_000746679.1.51469 WP_000746679.1.51492 WP_000746679.1.515 WP_000746679.1.51527 WP_000746679.1.5155 WP_000746679.1.51559 WP_000746679.1.51575 WP_000746679.1.51590 WP_000746679.1.51619 WP_000746679.1.51623 WP_000746679.1.51657 WP_000746679.1.51665 WP_000746679.1.51702 WP_000746679.1.51713 WP_000746679.1.51716 WP_000746679.1.51748 WP_000746679.1.51751 WP_000746679.1.51797 WP_000746679.1.51836 WP_000746679.1.51842 WP_000746679.1.51844 WP_000746679.1.51866 WP_000746679.1.51871 WP_000746679.1.51883 WP_000746679.1.51924 WP_000746679.1.51936 WP_000746679.1.51952 WP_000746679.1.51971 WP_000746679.1.51995 WP_000746679.1.52078 WP_000746679.1.521 WP_000746679.1.5213 WP_000746679.1.52151 WP_000746679.1.52182 WP_000746679.1.52185 WP_000746679.1.52193 WP_000746679.1.52224 WP_000746679.1.52251 WP_000746679.1.52296 WP_000746679.1.523 WP_000746679.1.52322 WP_000746679.1.52327 WP_000746679.1.52331 WP_000746679.1.52340 WP_000746679.1.52440 WP_000746679.1.52442 WP_000746679.1.52463 WP_000746679.1.52474 WP_000746679.1.52518 WP_000746679.1.52548 WP_000746679.1.52595 WP_000746679.1.52602 WP_000746679.1.52622 WP_000746679.1.52623 WP_000746679.1.52624 WP_000746679.1.52645 WP_000746679.1.52660 WP_000746679.1.52687 WP_000746679.1.52699 WP_000746679.1.52715 WP_000746679.1.52722 WP_000746679.1.52828 WP_000746679.1.52848 WP_000746679.1.52877 WP_000746679.1.52878 WP_000746679.1.52941 WP_000746679.1.52947 WP_000746679.1.52984 WP_000746679.1.52992 WP_000746679.1.53002 WP_000746679.1.53022 WP_000746679.1.53060 WP_000746679.1.53069 WP_000746679.1.53071 WP_000746679.1.53109 WP_000746679.1.53140 WP_000746679.1.53153 WP_000746679.1.53178 WP_000746679.1.53209 WP_000746679.1.53260 WP_000746679.1.53317 WP_000746679.1.53319 WP_000746679.1.5336 WP_000746679.1.53366 WP_000746679.1.53383 WP_000746679.1.53387 WP_000746679.1.53394 WP_000746679.1.53403 WP_000746679.1.53432 WP_000746679.1.53444 WP_000746679.1.53462 WP_000746679.1.53521 WP_000746679.1.53577 WP_000746679.1.53641 WP_000746679.1.53648 WP_000746679.1.53671 WP_000746679.1.53758 WP_000746679.1.53766 WP_000746679.1.5382 WP_000746679.1.53827 WP_000746679.1.53835 WP_000746679.1.53889 WP_000746679.1.53915 WP_000746679.1.53924 WP_000746679.1.53934 WP_000746679.1.53969 WP_000746679.1.53999 WP_000746679.1.5401 WP_000746679.1.54022 WP_000746679.1.54109 WP_000746679.1.54147 WP_000746679.1.54199 WP_000746679.1.54229 WP_000746679.1.54253 WP_000746679.1.54282 WP_000746679.1.54297 WP_000746679.1.54332 WP_000746679.1.54395 WP_000746679.1.544 WP_000746679.1.54413 WP_000746679.1.54426 WP_000746679.1.54503 WP_000746679.1.54510 WP_000746679.1.54518 WP_000746679.1.54539 WP_000746679.1.54551 WP_000746679.1.54572 WP_000746679.1.54637 WP_000746679.1.54675 WP_000746679.1.5469 WP_000746679.1.54733 WP_000746679.1.54745 WP_000746679.1.54753 WP_000746679.1.54819 WP_000746679.1.54826 WP_000746679.1.54878 WP_000746679.1.54955 WP_000746679.1.54995 WP_000746679.1.55014 WP_000746679.1.55100 WP_000746679.1.5519 WP_000746679.1.55192 WP_000746679.1.55214 WP_000746679.1.55220 WP_000746679.1.55274 WP_000746679.1.55301 WP_000746679.1.55306 WP_000746679.1.55309 WP_000746679.1.55367 WP_000746679.1.55369 WP_000746679.1.55403 WP_000746679.1.55405 WP_000746679.1.55421 WP_000746679.1.55442 WP_000746679.1.55508 WP_000746679.1.55538 WP_000746679.1.5554 WP_000746679.1.55544 WP_000746679.1.55558 WP_000746679.1.5556 WP_000746679.1.55573 WP_000746679.1.55583 WP_000746679.1.5559 WP_000746679.1.55628 WP_000746679.1.55637 WP_000746679.1.55653 WP_000746679.1.557 WP_000746679.1.55728 WP_000746679.1.55746 WP_000746679.1.55786 WP_000746679.1.5580 WP_000746679.1.55818 WP_000746679.1.55831 WP_000746679.1.55835 WP_000746679.1.55854 WP_000746679.1.55867 WP_000746679.1.55886 WP_000746679.1.5589 WP_000746679.1.5590 WP_000746679.1.55904 WP_000746679.1.55916 WP_000746679.1.55933 WP_000746679.1.55953 WP_000746679.1.56000 WP_000746679.1.56025 WP_000746679.1.56039 WP_000746679.1.56048 WP_000746679.1.56078 WP_000746679.1.56098 WP_000746679.1.56214 WP_000746679.1.56225 WP_000746679.1.5623 WP_000746679.1.56239 WP_000746679.1.56281 WP_000746679.1.56332 WP_000746679.1.56333 WP_000746679.1.56343 WP_000746679.1.5635 WP_000746679.1.5637 WP_000746679.1.56377 WP_000746679.1.56400 WP_000746679.1.5644 WP_000746679.1.56453 WP_000746679.1.56496 WP_000746679.1.56558 WP_000746679.1.56570 WP_000746679.1.5658 WP_000746679.1.56598 WP_000746679.1.566 WP_000746679.1.56628 WP_000746679.1.56641 WP_000746679.1.5665 WP_000746679.1.56658 WP_000746679.1.5666 WP_000746679.1.56723 WP_000746679.1.5677 WP_000746679.1.56778 WP_000746679.1.56794 WP_000746679.1.56806 WP_000746679.1.56815 WP_000746679.1.56856 WP_000746679.1.5686 WP_000746679.1.56865 WP_000746679.1.56878 WP_000746679.1.569 WP_000746679.1.56986 WP_000746679.1.57047 WP_000746679.1.57073 WP_000746679.1.57075 WP_000746679.1.57097 WP_000746679.1.57109 WP_000746679.1.57170 WP_000746679.1.57175 WP_000746679.1.5718 WP_000746679.1.57190 WP_000746679.1.57214 WP_000746679.1.57223 WP_000746679.1.57265 WP_000746679.1.57309 WP_000746679.1.57316 WP_000746679.1.57370 WP_000746679.1.57376 WP_000746679.1.57445 WP_000746679.1.57481 WP_000746679.1.57507 WP_000746679.1.5752 WP_000746679.1.57594 WP_000746679.1.5763 WP_000746679.1.57650 WP_000746679.1.57665 WP_000746679.1.57682 WP_000746679.1.57692 WP_000746679.1.5770 WP_000746679.1.57720 WP_000746679.1.57730 WP_000746679.1.57734 WP_000746679.1.57754 WP_000746679.1.57761 WP_000746679.1.57770 WP_000746679.1.57808 WP_000746679.1.57819 WP_000746679.1.57837 WP_000746679.1.57840 WP_000746679.1.57861 WP_000746679.1.57878 WP_000746679.1.57888 WP_000746679.1.579 WP_000746679.1.5791 WP_000746679.1.57910 WP_000746679.1.57915 WP_000746679.1.57943 WP_000746679.1.57944 WP_000746679.1.57952 WP_000746679.1.57974 WP_000746679.1.58005 WP_000746679.1.58014 WP_000746679.1.58016 WP_000746679.1.58017 WP_000746679.1.58049 WP_000746679.1.58050 WP_000746679.1.58074 WP_000746679.1.58116 WP_000746679.1.58127 WP_000746679.1.58148 WP_000746679.1.58158 WP_000746679.1.5816 WP_000746679.1.58175 WP_000746679.1.58277 WP_000746679.1.58317 WP_000746679.1.58352 WP_000746679.1.58364 WP_000746679.1.58388 WP_000746679.1.58395 WP_000746679.1.58413 WP_000746679.1.58430 WP_000746679.1.58473 WP_000746679.1.58512 WP_000746679.1.58530 WP_000746679.1.58549 WP_000746679.1.5857 WP_000746679.1.58571 WP_000746679.1.58592 WP_000746679.1.58598 WP_000746679.1.58701 WP_000746679.1.58704 WP_000746679.1.58735 WP_000746679.1.58760 WP_000746679.1.58763 WP_000746679.1.58772 WP_000746679.1.58798 WP_000746679.1.5880 WP_000746679.1.58833 WP_000746679.1.58934 WP_000746679.1.58960 WP_000746679.1.58981 WP_000746679.1.58991 WP_000746679.1.59011 WP_000746679.1.59014 WP_000746679.1.59039 WP_000746679.1.59077 WP_000746679.1.59124 WP_000746679.1.59135 WP_000746679.1.59146 WP_000746679.1.5920 WP_000746679.1.59203 WP_000746679.1.59213 WP_000746679.1.59311 WP_000746679.1.59337 WP_000746679.1.59398 WP_000746679.1.5940 WP_000746679.1.59401 WP_000746679.1.59404 WP_000746679.1.59441 WP_000746679.1.59462 WP_000746679.1.59464 WP_000746679.1.59498 WP_000746679.1.59540 WP_000746679.1.59546 WP_000746679.1.59598 WP_000746679.1.59668 WP_000746679.1.59669 WP_000746679.1.59671 WP_000746679.1.5972 WP_000746679.1.59736 WP_000746679.1.59787 WP_000746679.1.5982 WP_000746679.1.59822 WP_000746679.1.59874 WP_000746679.1.59896 WP_000746679.1.59907 WP_000746679.1.59915 WP_000746679.1.60001 WP_000746679.1.60006 WP_000746679.1.6006 WP_000746679.1.60107 WP_000746679.1.6011 WP_000746679.1.60123 WP_000746679.1.60124 WP_000746679.1.60147 WP_000746679.1.60149 WP_000746679.1.60157 WP_000746679.1.6017 WP_000746679.1.60227 WP_000746679.1.60302 WP_000746679.1.6034 WP_000746679.1.60345 WP_000746679.1.60353 WP_000746679.1.60360 WP_000746679.1.60382 WP_000746679.1.60414 WP_000746679.1.60434 WP_000746679.1.60473 WP_000746679.1.60492 WP_000746679.1.60493 WP_000746679.1.60530 WP_000746679.1.60547 WP_000746679.1.60585 WP_000746679.1.60595 WP_000746679.1.60636 WP_000746679.1.60641 WP_000746679.1.60675 WP_000746679.1.60677 WP_000746679.1.60734 WP_000746679.1.60750 WP_000746679.1.60751 WP_000746679.1.60758 WP_000746679.1.60759 WP_000746679.1.60765 WP_000746679.1.60778 WP_000746679.1.60813 WP_000746679.1.60820 WP_000746679.1.60845 WP_000746679.1.6085 WP_000746679.1.60869 WP_000746679.1.60888 WP_000746679.1.60912 WP_000746679.1.60923 WP_000746679.1.60943 WP_000746679.1.60948 WP_000746679.1.60949 WP_000746679.1.60965 WP_000746679.1.60991 WP_000746679.1.61013 WP_000746679.1.61023 WP_000746679.1.61026 WP_000746679.1.61029 WP_000746679.1.61031 WP_000746679.1.61077 WP_000746679.1.61082 WP_000746679.1.61115 WP_000746679.1.61139 WP_000746679.1.61187 WP_000746679.1.61189 WP_000746679.1.6119 WP_000746679.1.61215 WP_000746679.1.6123 WP_000746679.1.61261 WP_000746679.1.61263 WP_000746679.1.61271 WP_000746679.1.61277 WP_000746679.1.61286 WP_000746679.1.61289 WP_000746679.1.61313 WP_000746679.1.61316 WP_000746679.1.6136 WP_000746679.1.61375 WP_000746679.1.61393 WP_000746679.1.61430 WP_000746679.1.61439 WP_000746679.1.61440 WP_000746679.1.61555 WP_000746679.1.61564 WP_000746679.1.61585 WP_000746679.1.61597 WP_000746679.1.61615 WP_000746679.1.61639 WP_000746679.1.61641 WP_000746679.1.6166 WP_000746679.1.61687 WP_000746679.1.6170 WP_000746679.1.61705 WP_000746679.1.61747 WP_000746679.1.61749 WP_000746679.1.61800 WP_000746679.1.61802 WP_000746679.1.61838 WP_000746679.1.61864 WP_000746679.1.6189 WP_000746679.1.619 WP_000746679.1.61903 WP_000746679.1.61921 WP_000746679.1.61936 WP_000746679.1.61975 WP_000746679.1.61978 WP_000746679.1.62002 WP_000746679.1.6201 WP_000746679.1.62028 WP_000746679.1.62069 WP_000746679.1.62071 WP_000746679.1.6208 WP_000746679.1.62096 WP_000746679.1.62160 WP_000746679.1.62229 WP_000746679.1.62247 WP_000746679.1.62254 WP_000746679.1.62265 WP_000746679.1.62346 WP_000746679.1.62352 WP_000746679.1.62382 WP_000746679.1.62383 WP_000746679.1.62398 WP_000746679.1.62414 WP_000746679.1.62429 WP_000746679.1.62453 WP_000746679.1.62474 WP_000746679.1.62482 WP_000746679.1.62492 WP_000746679.1.62496 WP_000746679.1.6250 WP_000746679.1.62553 WP_000746679.1.62602 WP_000746679.1.62653 WP_000746679.1.62671 WP_000746679.1.62674 WP_000746679.1.6268 WP_000746679.1.62684 WP_000746679.1.62723 WP_000746679.1.62764 WP_000746679.1.62771 WP_000746679.1.62822 WP_000746679.1.62824 WP_000746679.1.62831 WP_000746679.1.62863 WP_000746679.1.62880 WP_000746679.1.62927 WP_000746679.1.62970 WP_000746679.1.62974 WP_000746679.1.6298 WP_000746679.1.62998 WP_000746679.1.63003 WP_000746679.1.63027 WP_000746679.1.63052 WP_000746679.1.63062 WP_000746679.1.63070 WP_000746679.1.63083 WP_000746679.1.63085 WP_000746679.1.63139 WP_000746679.1.63140 WP_000746679.1.63142 WP_000746679.1.63162 WP_000746679.1.63220 WP_000746679.1.63266 WP_000746679.1.63280 WP_000746679.1.63289 WP_000746679.1.63304 WP_000746679.1.63313 WP_000746679.1.63333 WP_000746679.1.63341 WP_000746679.1.63364 WP_000746679.1.63365 WP_000746679.1.63441 WP_000746679.1.63469 WP_000746679.1.63471 WP_000746679.1.63589 WP_000746679.1.63673 WP_000746679.1.63678 WP_000746679.1.63726 WP_000746679.1.63729 WP_000746679.1.6374 WP_000746679.1.63751 WP_000746679.1.63759 WP_000746679.1.63760 WP_000746679.1.63774 WP_000746679.1.63828 WP_000746679.1.6388 WP_000746679.1.63907 WP_000746679.1.63937 WP_000746679.1.63947 WP_000746679.1.63987 WP_000746679.1.6403 WP_000746679.1.6408 WP_000746679.1.6412 WP_000746679.1.64192 WP_000746679.1.64230 WP_000746679.1.64250 WP_000746679.1.64334 WP_000746679.1.64351 WP_000746679.1.64367 WP_000746679.1.6438 WP_000746679.1.64397 WP_000746679.1.64456 WP_000746679.1.64457 WP_000746679.1.64473 WP_000746679.1.64525 WP_000746679.1.64565 WP_000746679.1.64583 WP_000746679.1.6459 WP_000746679.1.6462 WP_000746679.1.64677 WP_000746679.1.64686 WP_000746679.1.64720 WP_000746679.1.64765 WP_000746679.1.6479 WP_000746679.1.64858 WP_000746679.1.64873 WP_000746679.1.64879 WP_000746679.1.6488 WP_000746679.1.64893 WP_000746679.1.64896 WP_000746679.1.64897 WP_000746679.1.64899 WP_000746679.1.64928 WP_000746679.1.64935 WP_000746679.1.64961 WP_000746679.1.65044 WP_000746679.1.65082 WP_000746679.1.65125 WP_000746679.1.65132 WP_000746679.1.65153 WP_000746679.1.65156 WP_000746679.1.65158 WP_000746679.1.65180 WP_000746679.1.65193 WP_000746679.1.65214 WP_000746679.1.65217 WP_000746679.1.65243 WP_000746679.1.65259 WP_000746679.1.65317 WP_000746679.1.65361 WP_000746679.1.65367 WP_000746679.1.65419 WP_000746679.1.65423 WP_000746679.1.65432 WP_000746679.1.65443 WP_000746679.1.65451 WP_000746679.1.6547 WP_000746679.1.65470 WP_000746679.1.65504 WP_000746679.1.6551 WP_000746679.1.65520 WP_000746679.1.65541 WP_000746679.1.65544 WP_000746679.1.65555 WP_000746679.1.65562 WP_000746679.1.65653 WP_000746679.1.65663 WP_000746679.1.65675 WP_000746679.1.65689 WP_000746679.1.65693 WP_000746679.1.65700 WP_000746679.1.65703 WP_000746679.1.65705 WP_000746679.1.65750 WP_000746679.1.65752 WP_000746679.1.65808 WP_000746679.1.65842 WP_000746679.1.65856 WP_000746679.1.65922 WP_000746679.1.65931 WP_000746679.1.65948 WP_000746679.1.66009 WP_000746679.1.66081 WP_000746679.1.661 WP_000746679.1.66120 WP_000746679.1.66133 WP_000746679.1.66175 WP_000746679.1.66262 WP_000746679.1.66281 WP_000746679.1.66302 WP_000746679.1.66369 WP_000746679.1.66433 WP_000746679.1.66505 WP_000746679.1.66519 WP_000746679.1.66542 WP_000746679.1.66554 WP_000746679.1.66564 WP_000746679.1.66576 WP_000746679.1.66588 WP_000746679.1.66601 WP_000746679.1.66606 WP_000746679.1.66655 WP_000746679.1.66664 WP_000746679.1.66677 WP_000746679.1.66711 WP_000746679.1.66712 WP_000746679.1.6674 WP_000746679.1.66786 WP_000746679.1.66818 WP_000746679.1.6684 WP_000746679.1.66979 WP_000746679.1.67006 WP_000746679.1.67090 WP_000746679.1.67112 WP_000746679.1.67135 WP_000746679.1.67191 WP_000746679.1.67204 WP_000746679.1.6722 WP_000746679.1.67266 WP_000746679.1.67297 WP_000746679.1.67329 WP_000746679.1.67333 WP_000746679.1.67379 WP_000746679.1.67386 WP_000746679.1.6740 WP_000746679.1.67414 WP_000746679.1.67463 WP_000746679.1.67480 WP_000746679.1.67505 WP_000746679.1.67507 WP_000746679.1.67513 WP_000746679.1.67520 WP_000746679.1.67521 WP_000746679.1.67554 WP_000746679.1.67572 WP_000746679.1.67609 WP_000746679.1.67612 WP_000746679.1.67618 WP_000746679.1.67632 WP_000746679.1.67651 WP_000746679.1.67652 WP_000746679.1.67703 WP_000746679.1.67713 WP_000746679.1.67722 WP_000746679.1.67752 WP_000746679.1.67754 WP_000746679.1.67767 WP_000746679.1.67815 WP_000746679.1.6786 WP_000746679.1.67865 WP_000746679.1.67889 WP_000746679.1.67925 WP_000746679.1.67941 WP_000746679.1.67986 WP_000746679.1.68001 WP_000746679.1.68033 WP_000746679.1.68054 WP_000746679.1.68066 WP_000746679.1.68102 WP_000746679.1.6811 WP_000746679.1.68111 WP_000746679.1.68160 WP_000746679.1.68161 WP_000746679.1.68199 WP_000746679.1.68219 WP_000746679.1.68261 WP_000746679.1.68286 WP_000746679.1.68295 WP_000746679.1.6830 WP_000746679.1.68307 WP_000746679.1.6834 WP_000746679.1.68343 WP_000746679.1.68351 WP_000746679.1.68367 WP_000746679.1.6839 WP_000746679.1.68397 WP_000746679.1.68404 WP_000746679.1.68416 WP_000746679.1.68425 WP_000746679.1.68483 WP_000746679.1.68489 WP_000746679.1.68522 WP_000746679.1.68542 WP_000746679.1.68565 WP_000746679.1.68575 WP_000746679.1.68650 WP_000746679.1.68699 WP_000746679.1.68703 WP_000746679.1.68728 WP_000746679.1.68737 WP_000746679.1.68775 WP_000746679.1.68813 WP_000746679.1.68831 WP_000746679.1.68854 WP_000746679.1.68875 WP_000746679.1.68917 WP_000746679.1.68943 WP_000746679.1.68944 WP_000746679.1.69045 WP_000746679.1.69087 WP_000746679.1.69089 WP_000746679.1.69110 WP_000746679.1.69111 WP_000746679.1.69125 WP_000746679.1.6917 WP_000746679.1.69191 WP_000746679.1.69219 WP_000746679.1.69222 WP_000746679.1.69237 WP_000746679.1.69280 WP_000746679.1.69314 WP_000746679.1.69366 WP_000746679.1.69378 WP_000746679.1.69395 WP_000746679.1.69415 WP_000746679.1.69446 WP_000746679.1.69476 WP_000746679.1.69477 WP_000746679.1.69480 WP_000746679.1.69484 WP_000746679.1.695 WP_000746679.1.69552 WP_000746679.1.69559 WP_000746679.1.69563 WP_000746679.1.69622 WP_000746679.1.69679 WP_000746679.1.69685 WP_000746679.1.69718 WP_000746679.1.69877 WP_000746679.1.69878 WP_000746679.1.69921 WP_000746679.1.69987 WP_000746679.1.70024 WP_000746679.1.70048 WP_000746679.1.70089 WP_000746679.1.70105 WP_000746679.1.7012 WP_000746679.1.70133 WP_000746679.1.7024 WP_000746679.1.70253 WP_000746679.1.70273 WP_000746679.1.7030 WP_000746679.1.70338 WP_000746679.1.7034 WP_000746679.1.70344 WP_000746679.1.70349 WP_000746679.1.70361 WP_000746679.1.70389 WP_000746679.1.7043 WP_000746679.1.70438 WP_000746679.1.70451 WP_000746679.1.70459 WP_000746679.1.70462 WP_000746679.1.7053 WP_000746679.1.70546 WP_000746679.1.70572 WP_000746679.1.7061 WP_000746679.1.70635 WP_000746679.1.70641 WP_000746679.1.70651 WP_000746679.1.7067 WP_000746679.1.7071 WP_000746679.1.7073 WP_000746679.1.70790 WP_000746679.1.70791 WP_000746679.1.70818 WP_000746679.1.70823 WP_000746679.1.70855 WP_000746679.1.7089 WP_000746679.1.70917 WP_000746679.1.70924 WP_000746679.1.70930 WP_000746679.1.70943 WP_000746679.1.71043 WP_000746679.1.71058 WP_000746679.1.71059 WP_000746679.1.71073 WP_000746679.1.7109 WP_000746679.1.711 WP_000746679.1.71130 WP_000746679.1.71180 WP_000746679.1.71196 WP_000746679.1.7120 WP_000746679.1.71257 WP_000746679.1.71295 WP_000746679.1.71298 WP_000746679.1.71325 WP_000746679.1.71332 WP_000746679.1.71345 WP_000746679.1.71351 WP_000746679.1.71359 WP_000746679.1.71431 WP_000746679.1.71463 WP_000746679.1.7150 WP_000746679.1.71519 WP_000746679.1.71521 WP_000746679.1.71529 WP_000746679.1.71543 WP_000746679.1.71596 WP_000746679.1.71602 WP_000746679.1.7161 WP_000746679.1.71644 WP_000746679.1.71662 WP_000746679.1.71676 WP_000746679.1.71735 WP_000746679.1.71772 WP_000746679.1.71788 WP_000746679.1.7179 WP_000746679.1.71859 WP_000746679.1.71861 WP_000746679.1.71888 WP_000746679.1.71925 WP_000746679.1.71949 WP_000746679.1.7198 WP_000746679.1.71989 WP_000746679.1.72026 WP_000746679.1.72031 WP_000746679.1.72035 WP_000746679.1.72067 WP_000746679.1.72089 WP_000746679.1.72099 WP_000746679.1.72112 WP_000746679.1.72169 WP_000746679.1.72205 WP_000746679.1.72271 WP_000746679.1.72330 WP_000746679.1.72347 WP_000746679.1.7236 WP_000746679.1.72366 WP_000746679.1.7242 WP_000746679.1.72424 WP_000746679.1.72433 WP_000746679.1.72547 WP_000746679.1.72564 WP_000746679.1.72654 WP_000746679.1.7278 WP_000746679.1.72787 WP_000746679.1.72832 WP_000746679.1.72834 WP_000746679.1.72835 WP_000746679.1.72903 WP_000746679.1.72904 WP_000746679.1.7292 WP_000746679.1.72935 WP_000746679.1.72945 WP_000746679.1.72965 WP_000746679.1.73004 WP_000746679.1.73017 WP_000746679.1.73019 WP_000746679.1.73022 WP_000746679.1.73037 WP_000746679.1.73074 WP_000746679.1.73122 WP_000746679.1.73132 WP_000746679.1.73246 WP_000746679.1.73265 WP_000746679.1.73286 WP_000746679.1.73312 WP_000746679.1.73386 WP_000746679.1.73456 WP_000746679.1.73467 WP_000746679.1.73501 WP_000746679.1.73526 WP_000746679.1.73571 WP_000746679.1.73591 WP_000746679.1.736 WP_000746679.1.73639 WP_000746679.1.73685 WP_000746679.1.73733 WP_000746679.1.73735 WP_000746679.1.73736 WP_000746679.1.73759 WP_000746679.1.73786 WP_000746679.1.7380 WP_000746679.1.73834 WP_000746679.1.73858 WP_000746679.1.73880 WP_000746679.1.73910 WP_000746679.1.73920 WP_000746679.1.73961 WP_000746679.1.73969 WP_000746679.1.73976 WP_000746679.1.73983 WP_000746679.1.74006 WP_000746679.1.74010 WP_000746679.1.74013 WP_000746679.1.74027 WP_000746679.1.74081 WP_000746679.1.74157 WP_000746679.1.74158 WP_000746679.1.74161 WP_000746679.1.74173 WP_000746679.1.7418 WP_000746679.1.74183 WP_000746679.1.74187 WP_000746679.1.74201 WP_000746679.1.74216 WP_000746679.1.74234 WP_000746679.1.74237 WP_000746679.1.7427 WP_000746679.1.7428 WP_000746679.1.74338 WP_000746679.1.7434 WP_000746679.1.74353 WP_000746679.1.74356 WP_000746679.1.74380 WP_000746679.1.74429 WP_000746679.1.74457 WP_000746679.1.74486 WP_000746679.1.74533 WP_000746679.1.74556 WP_000746679.1.7457 WP_000746679.1.74587 WP_000746679.1.74610 WP_000746679.1.74638 WP_000746679.1.74696 WP_000746679.1.74704 WP_000746679.1.74731 WP_000746679.1.74747 WP_000746679.1.74781 WP_000746679.1.74802 WP_000746679.1.74849 WP_000746679.1.74866 WP_000746679.1.74890 WP_000746679.1.74899 WP_000746679.1.74911 WP_000746679.1.74922 WP_000746679.1.74961 WP_000746679.1.74963 WP_000746679.1.74994 WP_000746679.1.74999 WP_000746679.1.7500 WP_000746679.1.75006 WP_000746679.1.75038 WP_000746679.1.75044 WP_000746679.1.75048 WP_000746679.1.75052 WP_000746679.1.75122 WP_000746679.1.75186 WP_000746679.1.75227 WP_000746679.1.75252 WP_000746679.1.75253 WP_000746679.1.75294 WP_000746679.1.75298 WP_000746679.1.75320 WP_000746679.1.75327 WP_000746679.1.75349 WP_000746679.1.75365 WP_000746679.1.75369 WP_000746679.1.75399 WP_000746679.1.75411 WP_000746679.1.7542 WP_000746679.1.75438 WP_000746679.1.75440 WP_000746679.1.75481 WP_000746679.1.75506 WP_000746679.1.75509 WP_000746679.1.75527 WP_000746679.1.75542 WP_000746679.1.75551 WP_000746679.1.7561 WP_000746679.1.75623 WP_000746679.1.75649 WP_000746679.1.75652 WP_000746679.1.75680 WP_000746679.1.75685 WP_000746679.1.75769 WP_000746679.1.75770 WP_000746679.1.75775 WP_000746679.1.758 WP_000746679.1.75824 WP_000746679.1.75830 WP_000746679.1.7584 WP_000746679.1.75856 WP_000746679.1.75879 WP_000746679.1.75881 WP_000746679.1.75885 WP_000746679.1.75929 WP_000746679.1.75952 WP_000746679.1.7596 WP_000746679.1.75969 WP_000746679.1.76010 WP_000746679.1.76015 WP_000746679.1.76071 WP_000746679.1.76073 WP_000746679.1.76095 WP_000746679.1.76112 WP_000746679.1.76136 WP_000746679.1.76143 WP_000746679.1.76185 WP_000746679.1.76230 WP_000746679.1.76234 WP_000746679.1.7624 WP_000746679.1.7625 WP_000746679.1.76258 WP_000746679.1.76261 WP_000746679.1.76323 WP_000746679.1.76332 WP_000746679.1.76333 WP_000746679.1.76337 WP_000746679.1.76351 WP_000746679.1.7638 WP_000746679.1.76419 WP_000746679.1.76420 WP_000746679.1.76421 WP_000746679.1.76482 WP_000746679.1.76604 WP_000746679.1.76606 WP_000746679.1.76624 WP_000746679.1.76648 WP_000746679.1.76686 WP_000746679.1.76690 WP_000746679.1.76693 WP_000746679.1.7675 WP_000746679.1.76790 WP_000746679.1.76792 WP_000746679.1.768 WP_000746679.1.76816 WP_000746679.1.76839 WP_000746679.1.76845 WP_000746679.1.7686 WP_000746679.1.76867 WP_000746679.1.76897 WP_000746679.1.76921 WP_000746679.1.76944 WP_000746679.1.76952 WP_000746679.1.76998 WP_000746679.1.77013 WP_000746679.1.77027 WP_000746679.1.77031 WP_000746679.1.77041 WP_000746679.1.77050 WP_000746679.1.77060 WP_000746679.1.77062 WP_000746679.1.77112 WP_000746679.1.77145 WP_000746679.1.77176 WP_000746679.1.77259 WP_000746679.1.77305 WP_000746679.1.77354 WP_000746679.1.77426 WP_000746679.1.77446 WP_000746679.1.7745 WP_000746679.1.7746 WP_000746679.1.77489 WP_000746679.1.77497 WP_000746679.1.77520 WP_000746679.1.77527 WP_000746679.1.77533 WP_000746679.1.77536 WP_000746679.1.77572 WP_000746679.1.77603 WP_000746679.1.77606 WP_000746679.1.77674 WP_000746679.1.77738 WP_000746679.1.7774 WP_000746679.1.77743 WP_000746679.1.77745 WP_000746679.1.77805 WP_000746679.1.77818 WP_000746679.1.77822 WP_000746679.1.77827 WP_000746679.1.77832 WP_000746679.1.77848 WP_000746679.1.77858 WP_000746679.1.7787 WP_000746679.1.77896 WP_000746679.1.77908 WP_000746679.1.77957 WP_000746679.1.78002 WP_000746679.1.78050 WP_000746679.1.78054 WP_000746679.1.78091 WP_000746679.1.78126 WP_000746679.1.78173 WP_000746679.1.78185 WP_000746679.1.78189 WP_000746679.1.78207 WP_000746679.1.78252 WP_000746679.1.78254 WP_000746679.1.78257 WP_000746679.1.7827 WP_000746679.1.78311 WP_000746679.1.78332 WP_000746679.1.78365 WP_000746679.1.78404 WP_000746679.1.78458 WP_000746679.1.7850 WP_000746679.1.78550 WP_000746679.1.78558 WP_000746679.1.7857 WP_000746679.1.78582 WP_000746679.1.78596 WP_000746679.1.78604 WP_000746679.1.78625 WP_000746679.1.78633 WP_000746679.1.78653 WP_000746679.1.78667 WP_000746679.1.78728 WP_000746679.1.78803 WP_000746679.1.78819 WP_000746679.1.78841 WP_000746679.1.78872 WP_000746679.1.7888 WP_000746679.1.78897 WP_000746679.1.78934 WP_000746679.1.78946 WP_000746679.1.78983 WP_000746679.1.7900 WP_000746679.1.79006 WP_000746679.1.79037 WP_000746679.1.79038 WP_000746679.1.79051 WP_000746679.1.79085 WP_000746679.1.79114 WP_000746679.1.79131 WP_000746679.1.79170 WP_000746679.1.79197 WP_000746679.1.79208 WP_000746679.1.79223 WP_000746679.1.79227 WP_000746679.1.79244 WP_000746679.1.7931 WP_000746679.1.79310 WP_000746679.1.79314 WP_000746679.1.79320 WP_000746679.1.79322 WP_000746679.1.79332 WP_000746679.1.79334 WP_000746679.1.79367 WP_000746679.1.79374 WP_000746679.1.79436 WP_000746679.1.79461 WP_000746679.1.79473 WP_000746679.1.79476 WP_000746679.1.79487 WP_000746679.1.79539 WP_000746679.1.79543 WP_000746679.1.79556 WP_000746679.1.79626 WP_000746679.1.79646 WP_000746679.1.79662 WP_000746679.1.79672 WP_000746679.1.79706 WP_000746679.1.79810 WP_000746679.1.79822 WP_000746679.1.79831 WP_000746679.1.79834 WP_000746679.1.79837 WP_000746679.1.7989 WP_000746679.1.79896 WP_000746679.1.79911 WP_000746679.1.79919 WP_000746679.1.7992 WP_000746679.1.79941 WP_000746679.1.79961 WP_000746679.1.79971 WP_000746679.1.79991 WP_000746679.1.80000 WP_000746679.1.80032 WP_000746679.1.80034 WP_000746679.1.80042 WP_000746679.1.80079 WP_000746679.1.80109 WP_000746679.1.80127 WP_000746679.1.80147 WP_000746679.1.80159 WP_000746679.1.80203 WP_000746679.1.80287 WP_000746679.1.80290 WP_000746679.1.80303 WP_000746679.1.8031 WP_000746679.1.8035 WP_000746679.1.80358 WP_000746679.1.80378 WP_000746679.1.8043 WP_000746679.1.80472 WP_000746679.1.80482 WP_000746679.1.80530 WP_000746679.1.8065 WP_000746679.1.8066 WP_000746679.1.80687 WP_000746679.1.80717 WP_000746679.1.80761 WP_000746679.1.80763 WP_000746679.1.80781 WP_000746679.1.80786 WP_000746679.1.80793 WP_000746679.1.80801 WP_000746679.1.80828 WP_000746679.1.80833 WP_000746679.1.8084 WP_000746679.1.8085 WP_000746679.1.80872 WP_000746679.1.80962 WP_000746679.1.80979 WP_000746679.1.80980 WP_000746679.1.81085 WP_000746679.1.81092 WP_000746679.1.81114 WP_000746679.1.81157 WP_000746679.1.81171 WP_000746679.1.81234 WP_000746679.1.8125 WP_000746679.1.81252 WP_000746679.1.8135 WP_000746679.1.81385 WP_000746679.1.81389 WP_000746679.1.8142 WP_000746679.1.81436 WP_000746679.1.8144 WP_000746679.1.81464 WP_000746679.1.81467 WP_000746679.1.81549 WP_000746679.1.81572 WP_000746679.1.81599 WP_000746679.1.81610 WP_000746679.1.81637 WP_000746679.1.81718 WP_000746679.1.81734 WP_000746679.1.81740 WP_000746679.1.81758 WP_000746679.1.8176 WP_000746679.1.81800 WP_000746679.1.81810 WP_000746679.1.81812 WP_000746679.1.81831 WP_000746679.1.81861 WP_000746679.1.81870 WP_000746679.1.8188 WP_000746679.1.81897 WP_000746679.1.81903 WP_000746679.1.81904 WP_000746679.1.81905 WP_000746679.1.81906 WP_000746679.1.81919 WP_000746679.1.81940 WP_000746679.1.81944 WP_000746679.1.81955 WP_000746679.1.81996 WP_000746679.1.81999 WP_000746679.1.82009 WP_000746679.1.82015 WP_000746679.1.82053 WP_000746679.1.82121 WP_000746679.1.82161 WP_000746679.1.82167 WP_000746679.1.82219 WP_000746679.1.82247 WP_000746679.1.82259 WP_000746679.1.82340 WP_000746679.1.82354 WP_000746679.1.82358 WP_000746679.1.82368 WP_000746679.1.8244 WP_000746679.1.82447 WP_000746679.1.8246 WP_000746679.1.82467 WP_000746679.1.82548 WP_000746679.1.82612 WP_000746679.1.8265 WP_000746679.1.82709 WP_000746679.1.82724 WP_000746679.1.82760 WP_000746679.1.82762 WP_000746679.1.82796 WP_000746679.1.8280 WP_000746679.1.82802 WP_000746679.1.82829 WP_000746679.1.82835 WP_000746679.1.82862 WP_000746679.1.8289 WP_000746679.1.82916 WP_000746679.1.82931 WP_000746679.1.82976 WP_000746679.1.82980 WP_000746679.1.82984 WP_000746679.1.82997 WP_000746679.1.83011 WP_000746679.1.83013 WP_000746679.1.83050 WP_000746679.1.83053 WP_000746679.1.83152 WP_000746679.1.83153 WP_000746679.1.83185 WP_000746679.1.83193 WP_000746679.1.83234 WP_000746679.1.83243 WP_000746679.1.8328 WP_000746679.1.83316 WP_000746679.1.83352 WP_000746679.1.83372 WP_000746679.1.83416 WP_000746679.1.83418 WP_000746679.1.83475 WP_000746679.1.83476 WP_000746679.1.83484 WP_000746679.1.83508 WP_000746679.1.83517 WP_000746679.1.83592 WP_000746679.1.83593 WP_000746679.1.83626 WP_000746679.1.83645 WP_000746679.1.83646 WP_000746679.1.83653 WP_000746679.1.83676 WP_000746679.1.83714 WP_000746679.1.83720 WP_000746679.1.83763 WP_000746679.1.83769 WP_000746679.1.83778 WP_000746679.1.83804 WP_000746679.1.83825 WP_000746679.1.8383 WP_000746679.1.83837 WP_000746679.1.83852 WP_000746679.1.83864 WP_000746679.1.83865 WP_000746679.1.83881 WP_000746679.1.83902 WP_000746679.1.83912 WP_000746679.1.83917 WP_000746679.1.83919 WP_000746679.1.83925 WP_000746679.1.83928 WP_000746679.1.83935 WP_000746679.1.83955 WP_000746679.1.83984 WP_000746679.1.84041 WP_000746679.1.84049 WP_000746679.1.84067 WP_000746679.1.84068 WP_000746679.1.84144 WP_000746679.1.84163 WP_000746679.1.84293 WP_000746679.1.84322 WP_000746679.1.84342 WP_000746679.1.84416 WP_000746679.1.84442 WP_000746679.1.84445 WP_000746679.1.84451 WP_000746679.1.84509 WP_000746679.1.84555 WP_000746679.1.84563 WP_000746679.1.84570 WP_000746679.1.84578 WP_000746679.1.84602 WP_000746679.1.84612 WP_000746679.1.84625 WP_000746679.1.84630 WP_000746679.1.84638 WP_000746679.1.84652 WP_000746679.1.84662 WP_000746679.1.8468 WP_000746679.1.84682 WP_000746679.1.8475 WP_000746679.1.84752 WP_000746679.1.84757 WP_000746679.1.84761 WP_000746679.1.84815 WP_000746679.1.84889 WP_000746679.1.84903 WP_000746679.1.84907 WP_000746679.1.84922 WP_000746679.1.8493 WP_000746679.1.85022 WP_000746679.1.85047 WP_000746679.1.85056 WP_000746679.1.85081 WP_000746679.1.85099 WP_000746679.1.851 WP_000746679.1.85132 WP_000746679.1.85135 WP_000746679.1.85144 WP_000746679.1.85151 WP_000746679.1.85213 WP_000746679.1.85224 WP_000746679.1.85226 WP_000746679.1.85235 WP_000746679.1.85238 WP_000746679.1.85294 WP_000746679.1.85297 WP_000746679.1.85351 WP_000746679.1.85383 WP_000746679.1.85395 WP_000746679.1.85404 WP_000746679.1.85445 WP_000746679.1.85455 WP_000746679.1.85462 WP_000746679.1.85471 WP_000746679.1.85474 WP_000746679.1.85492 WP_000746679.1.85506 WP_000746679.1.85515 WP_000746679.1.85519 WP_000746679.1.85542 WP_000746679.1.85547 WP_000746679.1.85586 WP_000746679.1.85607 WP_000746679.1.85649 WP_000746679.1.85678 WP_000746679.1.85705 WP_000746679.1.85758 WP_000746679.1.85795 WP_000746679.1.85796 WP_000746679.1.85809 WP_000746679.1.85816 WP_000746679.1.85834 WP_000746679.1.85844 WP_000746679.1.85873 WP_000746679.1.85927 WP_000746679.1.85950 WP_000746679.1.85993 WP_000746679.1.86018 WP_000746679.1.86072 WP_000746679.1.86101 WP_000746679.1.86106 WP_000746679.1.86123 WP_000746679.1.86144 WP_000746679.1.86154 WP_000746679.1.86158 WP_000746679.1.8617 WP_000746679.1.86178 WP_000746679.1.86188 WP_000746679.1.86207 WP_000746679.1.86256 WP_000746679.1.8627 WP_000746679.1.86270 WP_000746679.1.86304 WP_000746679.1.86344 WP_000746679.1.86367 WP_000746679.1.86378 WP_000746679.1.8643 WP_000746679.1.86439 WP_000746679.1.86482 WP_000746679.1.86505 WP_000746679.1.86523 WP_000746679.1.86542 WP_000746679.1.86628 WP_000746679.1.86629 WP_000746679.1.86706 WP_000746679.1.86754 WP_000746679.1.86792 WP_000746679.1.8681 WP_000746679.1.86838 WP_000746679.1.86911 WP_000746679.1.86940 WP_000746679.1.86955 WP_000746679.1.86961 WP_000746679.1.86977 WP_000746679.1.87021 WP_000746679.1.87022 WP_000746679.1.87042 WP_000746679.1.87057 WP_000746679.1.87072 WP_000746679.1.87090 WP_000746679.1.87119 WP_000746679.1.87122 WP_000746679.1.87141 WP_000746679.1.87175 WP_000746679.1.87194 WP_000746679.1.8720 WP_000746679.1.87250 WP_000746679.1.87260 WP_000746679.1.87261 WP_000746679.1.87263 WP_000746679.1.87285 WP_000746679.1.87290 WP_000746679.1.8731 WP_000746679.1.87391 WP_000746679.1.87396 WP_000746679.1.87397 WP_000746679.1.87425 WP_000746679.1.87434 WP_000746679.1.87457 WP_000746679.1.87461 WP_000746679.1.87466 WP_000746679.1.87475 WP_000746679.1.87498 WP_000746679.1.875 WP_000746679.1.87502 WP_000746679.1.87508 WP_000746679.1.87515 WP_000746679.1.8753 WP_000746679.1.87543 WP_000746679.1.87623 WP_000746679.1.87710 WP_000746679.1.87718 WP_000746679.1.87740 WP_000746679.1.87748 WP_000746679.1.87764 WP_000746679.1.8779 WP_000746679.1.87802 WP_000746679.1.87808 WP_000746679.1.87828 WP_000746679.1.87879 WP_000746679.1.87912 WP_000746679.1.87963 WP_000746679.1.87972 WP_000746679.1.87995 WP_000746679.1.88013 WP_000746679.1.88032 WP_000746679.1.88061 WP_000746679.1.88114 WP_000746679.1.88150 WP_000746679.1.88166 WP_000746679.1.8820 WP_000746679.1.88270 WP_000746679.1.88279 WP_000746679.1.88317 WP_000746679.1.88319 WP_000746679.1.88328 WP_000746679.1.88348 WP_000746679.1.88351 WP_000746679.1.88367 WP_000746679.1.88371 WP_000746679.1.88380 WP_000746679.1.88395 WP_000746679.1.88471 WP_000746679.1.88480 WP_000746679.1.88498 WP_000746679.1.88518 WP_000746679.1.88558 WP_000746679.1.8857 WP_000746679.1.88580 WP_000746679.1.88599 WP_000746679.1.88623 WP_000746679.1.88636 WP_000746679.1.88642 WP_000746679.1.88671 WP_000746679.1.88694 WP_000746679.1.8872 WP_000746679.1.88739 WP_000746679.1.88827 WP_000746679.1.88856 WP_000746679.1.88859 WP_000746679.1.88861 WP_000746679.1.88871 WP_000746679.1.88874 WP_000746679.1.8888 WP_000746679.1.88912 WP_000746679.1.88922 WP_000746679.1.88934 WP_000746679.1.8900 WP_000746679.1.89086 WP_000746679.1.89103 WP_000746679.1.8913 WP_000746679.1.89133 WP_000746679.1.89173 WP_000746679.1.89181 WP_000746679.1.89194 WP_000746679.1.89195 WP_000746679.1.89204 WP_000746679.1.89229 WP_000746679.1.89237 WP_000746679.1.8924 WP_000746679.1.89258 WP_000746679.1.89284 WP_000746679.1.89347 WP_000746679.1.89414 WP_000746679.1.89516 WP_000746679.1.8953 WP_000746679.1.89537 WP_000746679.1.89544 WP_000746679.1.89545 WP_000746679.1.89559 WP_000746679.1.89628 WP_000746679.1.89651 WP_000746679.1.89655 WP_000746679.1.89672 WP_000746679.1.89678 WP_000746679.1.89726 WP_000746679.1.89730 WP_000746679.1.89754 WP_000746679.1.89860 WP_000746679.1.89883 WP_000746679.1.89935 WP_000746679.1.89960 WP_000746679.1.90005 WP_000746679.1.90018 WP_000746679.1.90038 WP_000746679.1.90046 WP_000746679.1.90055 WP_000746679.1.90091 WP_000746679.1.90131 WP_000746679.1.90148 WP_000746679.1.90161 WP_000746679.1.90180 WP_000746679.1.90215 WP_000746679.1.9022 WP_000746679.1.90243 WP_000746679.1.90244 WP_000746679.1.90253 WP_000746679.1.90276 WP_000746679.1.9030 WP_000746679.1.90331 WP_000746679.1.90367 WP_000746679.1.90473 WP_000746679.1.90544 WP_000746679.1.90554 WP_000746679.1.90562 WP_000746679.1.90604 WP_000746679.1.90647 WP_000746679.1.90660 WP_000746679.1.90683 WP_000746679.1.90726 WP_000746679.1.90728 WP_000746679.1.90738 WP_000746679.1.9074 WP_000746679.1.90745 WP_000746679.1.90777 WP_000746679.1.90801 WP_000746679.1.90804 WP_000746679.1.90861 WP_000746679.1.90875 WP_000746679.1.90887 WP_000746679.1.90896 WP_000746679.1.90903 WP_000746679.1.90928 WP_000746679.1.9100 WP_000746679.1.91011 WP_000746679.1.91054 WP_000746679.1.91089 WP_000746679.1.91126 WP_000746679.1.9114 WP_000746679.1.91158 WP_000746679.1.91177 WP_000746679.1.912 WP_000746679.1.91233 WP_000746679.1.91246 WP_000746679.1.91258 WP_000746679.1.9127 WP_000746679.1.91279 WP_000746679.1.9130 WP_000746679.1.91300 WP_000746679.1.91310 WP_000746679.1.91316 WP_000746679.1.91332 WP_000746679.1.91346 WP_000746679.1.91357 WP_000746679.1.91364 WP_000746679.1.91380 WP_000746679.1.91382 WP_000746679.1.9140 WP_000746679.1.91420 WP_000746679.1.91427 WP_000746679.1.91465 WP_000746679.1.91487 WP_000746679.1.91500 WP_000746679.1.91501 WP_000746679.1.91542 WP_000746679.1.91547 WP_000746679.1.91559 WP_000746679.1.91573 WP_000746679.1.91581 WP_000746679.1.91587 WP_000746679.1.91591 WP_000746679.1.91635 WP_000746679.1.91639 WP_000746679.1.91749 WP_000746679.1.91771 WP_000746679.1.91781 WP_000746679.1.91791 WP_000746679.1.91800 WP_000746679.1.91816 WP_000746679.1.91829 WP_000746679.1.91895 WP_000746679.1.91911 WP_000746679.1.91928 WP_000746679.1.91950 WP_000746679.1.91955 WP_000746679.1.92 WP_000746679.1.92057 WP_000746679.1.92104 WP_000746679.1.92110 WP_000746679.1.92133 WP_000746679.1.92140 WP_000746679.1.92158 WP_000746679.1.92164 WP_000746679.1.92169 WP_000746679.1.92173 WP_000746679.1.92185 WP_000746679.1.92196 WP_000746679.1.92218 WP_000746679.1.92227 WP_000746679.1.9224 WP_000746679.1.92253 WP_000746679.1.92278 WP_000746679.1.92297 WP_000746679.1.92324 WP_000746679.1.9234 WP_000746679.1.9239 WP_000746679.1.92415 WP_000746679.1.92424 WP_000746679.1.92436 WP_000746679.1.92442 WP_000746679.1.92497 WP_000746679.1.92500 WP_000746679.1.92520 WP_000746679.1.92534 WP_000746679.1.92541 WP_000746679.1.92560 WP_000746679.1.92565 WP_000746679.1.92607 WP_000746679.1.92679 WP_000746679.1.92691 WP_000746679.1.92723 WP_000746679.1.92726 WP_000746679.1.92735 WP_000746679.1.92741 WP_000746679.1.92772 WP_000746679.1.92773 WP_000746679.1.92789 WP_000746679.1.92805 WP_000746679.1.92840 WP_000746679.1.92862 WP_000746679.1.92864 WP_000746679.1.9293 WP_000746679.1.92937 WP_000746679.1.92950 WP_000746679.1.9305 WP_000746679.1.93074 WP_000746679.1.93078 WP_000746679.1.93125 WP_000746679.1.93163 WP_000746679.1.93176 WP_000746679.1.93191 WP_000746679.1.93224 WP_000746679.1.93251 WP_000746679.1.93300 WP_000746679.1.93329 WP_000746679.1.93336 WP_000746679.1.93416 WP_000746679.1.93438 WP_000746679.1.93444 WP_000746679.1.9346 WP_000746679.1.93514 WP_000746679.1.9352 WP_000746679.1.9354 WP_000746679.1.93561 WP_000746679.1.9358 WP_000746679.1.93590 WP_000746679.1.93658 WP_000746679.1.93678 WP_000746679.1.93710 WP_000746679.1.93722 WP_000746679.1.93738 WP_000746679.1.93769 WP_000746679.1.93787 WP_000746679.1.93862 WP_000746679.1.9387 WP_000746679.1.93882 WP_000746679.1.93883 WP_000746679.1.93891 WP_000746679.1.93934 WP_000746679.1.93972 WP_000746679.1.93976 WP_000746679.1.9398 WP_000746679.1.93981 WP_000746679.1.94009 WP_000746679.1.94016 WP_000746679.1.94060 WP_000746679.1.94074 WP_000746679.1.94082 WP_000746679.1.94087 WP_000746679.1.94096 WP_000746679.1.94114 WP_000746679.1.94119 WP_000746679.1.94165 WP_000746679.1.94172 WP_000746679.1.94293 WP_000746679.1.94294 WP_000746679.1.94335 WP_000746679.1.94340 WP_000746679.1.94345 WP_000746679.1.9435 WP_000746679.1.9437 WP_000746679.1.94374 WP_000746679.1.94375 WP_000746679.1.94376 WP_000746679.1.94389 WP_000746679.1.94409 WP_000746679.1.94414 WP_000746679.1.94530 WP_000746679.1.94549 WP_000746679.1.94550 WP_000746679.1.94576 WP_000746679.1.94636 WP_000746679.1.94641 WP_000746679.1.94688 WP_000746679.1.94733 WP_000746679.1.94741 WP_000746679.1.94789 WP_000746679.1.94797 WP_000746679.1.94844 WP_000746679.1.94845 WP_000746679.1.9485 WP_000746679.1.94857 WP_000746679.1.94866 WP_000746679.1.94941 WP_000746679.1.9495 WP_000746679.1.94958 WP_000746679.1.9497 WP_000746679.1.94980 WP_000746679.1.94989 WP_000746679.1.94999 WP_000746679.1.95014 WP_000746679.1.95038 WP_000746679.1.95049 WP_000746679.1.95077 WP_000746679.1.95090 WP_000746679.1.9510 WP_000746679.1.95120 WP_000746679.1.95174 WP_000746679.1.95210 WP_000746679.1.95304 WP_000746679.1.95327 WP_000746679.1.95342 WP_000746679.1.95361 WP_000746679.1.95372 WP_000746679.1.9538 WP_000746679.1.95409 WP_000746679.1.95452 WP_000746679.1.95476 WP_000746679.1.95500 WP_000746679.1.95537 WP_000746679.1.95545 WP_000746679.1.95571 WP_000746679.1.95581 WP_000746679.1.95603 WP_000746679.1.95639 WP_000746679.1.95681 WP_000746679.1.95699 WP_000746679.1.95704 WP_000746679.1.95713 WP_000746679.1.95714 WP_000746679.1.95737 WP_000746679.1.95760 WP_000746679.1.95781 WP_000746679.1.95806 WP_000746679.1.95877 WP_000746679.1.95885 WP_000746679.1.95914 WP_000746679.1.95918 WP_000746679.1.95947 WP_000746679.1.95954 WP_000746679.1.95983 WP_000746679.1.95986 WP_000746679.1.95997 WP_000746679.1.96014 WP_000746679.1.96022 WP_000746679.1.96030 WP_000746679.1.96056 WP_000746679.1.96057 WP_000746679.1.96067 WP_000746679.1.96133 WP_000746679.1.96135 WP_000746679.1.96148 WP_000746679.1.96221 WP_000746679.1.96228 WP_000746679.1.96255 WP_000746679.1.96283 WP_000746679.1.96297 WP_000746679.1.96301 WP_000746679.1.96312 WP_000746679.1.96314 WP_000746679.1.96322 WP_000746679.1.96334 WP_000746679.1.96362 WP_000746679.1.96433 WP_000746679.1.96472 WP_000746679.1.96474 WP_000746679.1.96495 WP_000746679.1.9650 WP_000746679.1.96509 WP_000746679.1.96535 WP_000746679.1.96538 WP_000746679.1.96550 WP_000746679.1.96554 WP_000746679.1.96566 WP_000746679.1.96591 WP_000746679.1.96603 WP_000746679.1.96654 WP_000746679.1.96678 WP_000746679.1.96699 WP_000746679.1.96705 WP_000746679.1.9675 WP_000746679.1.96780 WP_000746679.1.96836 WP_000746679.1.9684 WP_000746679.1.96855 WP_000746679.1.96856 WP_000746679.1.96859 WP_000746679.1.96922 WP_000746679.1.96965 WP_000746679.1.96969 WP_000746679.1.96985 WP_000746679.1.96997 WP_000746679.1.97000 WP_000746679.1.97004 WP_000746679.1.97014 WP_000746679.1.97029 WP_000746679.1.97034 WP_000746679.1.97077 WP_000746679.1.97141 WP_000746679.1.97151 WP_000746679.1.97161 WP_000746679.1.97164 WP_000746679.1.97205 WP_000746679.1.97206 WP_000746679.1.97228 WP_000746679.1.97230 WP_000746679.1.97241 WP_000746679.1.97256 WP_000746679.1.97276 WP_000746679.1.97293 WP_000746679.1.97311 WP_000746679.1.97312 WP_000746679.1.97336 WP_000746679.1.97348 WP_000746679.1.97352 WP_000746679.1.97355 WP_000746679.1.97367 WP_000746679.1.97392 WP_000746679.1.97399 WP_000746679.1.97427 WP_000746679.1.97450 WP_000746679.1.97456 WP_000746679.1.97468 WP_000746679.1.97494 WP_000746679.1.97530 WP_000746679.1.97531 WP_000746679.1.97537 WP_000746679.1.97576 WP_000746679.1.97585 WP_000746679.1.97664 WP_000746679.1.97687 WP_000746679.1.97688 WP_000746679.1.97696 WP_000746679.1.97699 WP_000746679.1.97706 WP_000746679.1.97744 WP_000746679.1.97746 WP_000746679.1.97762 WP_000746679.1.97776 WP_000746679.1.9788 WP_000746679.1.97898 WP_000746679.1.97935 WP_000746679.1.97955 WP_000746679.1.97974 WP_000746679.1.97997 WP_000746679.1.98008 WP_000746679.1.98054 WP_000746679.1.98058 WP_000746679.1.98073 WP_000746679.1.98077 WP_000746679.1.98161 WP_000746679.1.98174 WP_000746679.1.98179 WP_000746679.1.98195 WP_000746679.1.98233 WP_000746679.1.98248 WP_000746679.1.98249 WP_000746679.1.98281 WP_000746679.1.98295 WP_000746679.1.98328 WP_000746679.1.98352 WP_000746679.1.98353 WP_000746679.1.98359 WP_000746679.1.98360 WP_000746679.1.98366 WP_000746679.1.98372 WP_000746679.1.98387 WP_000746679.1.98394 WP_000746679.1.98409 WP_000746679.1.98425 WP_000746679.1.98501 WP_000746679.1.98506 WP_000746679.1.98533 WP_000746679.1.98585 WP_000746679.1.98586 WP_000746679.1.98609 WP_000746679.1.98659 WP_000746679.1.98667 WP_000746679.1.98703 WP_000746679.1.9872 WP_000746679.1.98723 WP_000746679.1.98730 WP_000746679.1.98734 WP_000746679.1.98741 WP_000746679.1.98750 WP_000746679.1.98786 WP_000746679.1.98797 WP_000746679.1.98821 WP_000746679.1.98825 WP_000746679.1.98842 WP_000746679.1.98865 WP_000746679.1.98880 WP_000746679.1.98883 WP_000746679.1.98894 WP_000746679.1.98924 WP_000746679.1.98978 WP_000746679.1.98985 WP_000746679.1.99090 WP_000746679.1.9910 WP_000746679.1.99136 WP_000746679.1.99195 WP_000746679.1.99207 WP_000746679.1.99262 WP_000746679.1.99283 WP_000746679.1.99308 WP_000746679.1.99311 WP_000746679.1.99394 WP_000746679.1.99414 WP_000746679.1.99418 WP_000746679.1.99509 WP_000746679.1.99523 WP_000746679.1.99525 WP_000746679.1.9965 WP_000746679.1.99683 WP_000746679.1.99688 WP_000746679.1.99768 WP_000746679.1.99777 WP_000746679.1.99830 WP_000746679.1.99849 WP_000746679.1.9985 WP_000746679.1.99859 WP_000746679.1.99884 WP_000746679.1.99950 WP_000746679.1.99954 WP_000746679.1.99955 WP_000746679.1.99984 WP_000746679.1.99999 gi|470218230|ref|YP_007618624.1| gi|470198460|ref|YP_007584860.1| gi|15926079|ref|NP_373612.1| gi|537460121|ref|YP_008490561.1| gi|269202025|ref|YP_003281294.1| gi|384863732|ref|YP_005749091.1| jgi|Aspzo1|145361|fgenesh1_pg.16_#_45 gi|470196495|ref|YP_007582896.1| gi|15923368|ref|NP_370902.1| gi|150392910|ref|YP_001315585.1| gi|470192564|ref|YP_007578917.1| gi|470222053|ref|YP_007620610.1| 158878.SAV0378 158879.SA0363 359786.SaurJH9_0426 359787.SaurJH1_0437 418127.SAHV_0375 681288.SAAV_0345 gi|387149562|ref|YP_005741126.1| gi|386830048|ref|YP_006236702.1| gi|470194529|ref|YP_007580881.1| gi|470224018|ref|YP_007622597.1| gi|148266864|ref|YP_001245807.1| gi|470190599|ref|YP_007576909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]