SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156978706|ref|YP_001440965.1| from Staphylococcus aureus subsp. aureus Mu3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156978706|ref|YP_001440965.1|
Domain Number - Region: 94-202
Classification Level Classification E-value
Superfamily PH0156-like 0.00654
Family PH0156-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156978706|ref|YP_001440965.1|
Sequence length 208
Comment hypothetical protein SAHV_0375 [Staphylococcus aureus subsp. aureus Mu3]
Sequence
MKKRLLLSTFLASALILTGCASDQSDNEDHHTSTGIHAPKSAKKLETKDIFNSDKKNSDI
SDAEMKQAIEKYLSVNSDILDNKYIMQHKLDKQIDSQTKVTEKQAETLSHLSNLAVKNDL
HFKKFVTENNIPKEYKKPVELMMNYFKALNSTIANVDEDIEKLSYQPQNKINVVDVPTKY
AGDVNKKQQDKIKDFLKSKGIKSDVIDK
Download sequence
Identical sequences A0A0E1VLF5 A0A0H3JNQ2 A0A0H3JQ99 A0A168VLU5 T1Y744
jgi|Aspzo1|145361|fgenesh1_pg.16_#_45 gi|470224018|ref|YP_007622597.1| gi|150392910|ref|YP_001315585.1| gi|470198460|ref|YP_007584860.1| gi|148266864|ref|YP_001245807.1| gi|470222053|ref|YP_007620610.1| gi|470190599|ref|YP_007576909.1| gi|269202025|ref|YP_003281294.1| gi|470196495|ref|YP_007582896.1| gi|15923368|ref|NP_370902.1| gi|15926079|ref|NP_373612.1| 158878.SAV0378 158879.SA0363 359786.SaurJH9_0426 359787.SaurJH1_0437 418127.SAHV_0375 681288.SAAV_0345 gi|387149562|ref|YP_005741126.1| gi|537460121|ref|YP_008490561.1| gi|470194529|ref|YP_007580881.1| gi|156978706|ref|YP_001440965.1| gi|470218230|ref|YP_007618624.1| gi|386830048|ref|YP_006236702.1| gi|384863732|ref|YP_005749091.1| gi|470192564|ref|YP_007578917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]