SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182440134|ref|YP_001827853.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182440134|ref|YP_001827853.1|
Domain Number 1 Region: 984-1129
Classification Level Classification E-value
Superfamily TPR-like 8.6e-21
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 2 Region: 774-892
Classification Level Classification E-value
Superfamily TPR-like 1.86e-19
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number 3 Region: 277-463
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.2e-17
Family Extended AAA-ATPase domain 0.068
Further Details:      
 
Domain Number 4 Region: 858-976
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000128
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 5 Region: 649-766
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000739
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 
Domain Number 6 Region: 1151-1328
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000000143
Family Eukaryotic proteases 0.04
Further Details:      
 
Domain Number 7 Region: 8-183
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000000554
Family Eukaryotic proteases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182440134|ref|YP_001827853.1|
Sequence length 1375
Comment hypothetical protein SGR_6341 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MEPRRLVWVSTEDPKDSGTGYLIGPGLVLTALHVVHPGRRWAQGVRAHVGHPAFGDVVRR
RAEVRWPDPRLGNPPEGALDVALLTLDVPVPDTGDGPVRWGQPDGVDRVPFTGAGFPAFA
ADSGSEAHCEALNGTLSAVSTSTTGWVLDSEVWPAPGDGRKRPWAGASGSAIFLDDRLIG
VVVEDNRAMAWRRLHAVPVHKALADREFAGLVTLHGHPGTTTELERLTAGGEREQIEIGP
VPTLASAFQPRAGLRKQIEQARSGAGPVVLSQEASPKPTRILSGGGGVGKTQLAAAVAGD
ALQRGTDLVVWAAATEVQQVITQYARAAVRLRLPDVTGLDPEADARALLEWLATTRRRWL
VVLDDVTDPAGINPWWPLSRTGTGRVLATTRLLDSRLTGGDRARVPIDVYSAEEADAYVR
ERLTGEGMTHLLDDQVPALAEALGRLPLALGLAAAHLVNEDLSCSAYLELFADRHTRLEE
ALPATSDAEGYGLAITTALLLSLDAARAADPTGLVLPVLRLISLLDPAGHPHPLWASEPV
LAHLSSRKSPHEPTTSPAWARSALRVLHRYALVTSDPGAGPRAVRIHALTARAVREEIPS
TELAHLAYAAAGGLLSLWPEVDQPHPDLAAALRANTEILAGLTGDHLWHHPERHPVLYRA
GRSLYDAGMANAATAYWQHMADNAHRILGPRHPDALATRHNLAISHQQAGRTGEAIAIEE
EVLAESERVLGPDHPQTLDTRHNLAASYRQAGRIREAITIEEQVLADRARVLGTDHPNTL
DTRHNLATSYRQTGRVTEAITIERQVLTDSERVLGTEHPDTLTTRHNLAASYREAGRTDE
AISLQEQVLADRERVLGPDHPDTLTTRDVLAGAYREAGRTDEAISLQEQVVADRERVLGP
EHPDVLASRHNLALSYLRAGRAAAAVELLQRVLTDRERVLGTGHPDLVVIGSSLAHALGR
AGRTTAAIRLQEQVLTDSERVLGPDHPGTLNAGNNLANLYLRAGRTDTAIELLQRVLSDR
ERVLGPRHPGSLTTRSNLATAYEQGGRVVEAVDLQEQVLAERLRVLGPEHPDTLTTRHNL
AVSHRRAGRVEEAVGMLDNVLAERLRVLGPDHPDTAATRDYLAATRRALEAGAMPSGRVR
ESPVMDPRRLVCVGSDDGGFGTGYLIGPQLVLTALHLVRKGGRWTGLVSTRVGHPRFGDV
VRQPAQVCWPDPQHGVPPEDALDVALLWLDEPAPKTGEAPVRWGRPSGSARIPFTGAYFT
DRLGDQVRVEDYHGDLSPLAMSSAGWVLDCAVGLAAAGGHGGDQRWAGASGSAVFCHGRL
VGIAVQADHTDRRRLYAVPLHEALTLTGFADLVRRHGHPGTEAVWEKVTEELEIE
Download sequence
Identical sequences B1W5L3
gi|182440134|ref|YP_001827853.1| 455632.SGR_6341 WP_012381870.1.20467 WP_012381870.1.58927 WP_012381870.1.60218 WP_012381870.1.6712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]