SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339401|ref|YP_001520578.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339401|ref|YP_001520578.1|
Domain Number 1 Region: 539-833
Classification Level Classification E-value
Superfamily TPR-like 1.67e-44
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Domain Number 2 Region: 1039-1317
Classification Level Classification E-value
Superfamily TPR-like 3.13e-39
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 3 Region: 776-961
Classification Level Classification E-value
Superfamily TPR-like 9.86e-39
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Domain Number 4 Region: 273-410,439-498
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.42e-27
Family Prokaryotic proteases 0.0083
Further Details:      
 
Domain Number 5 Region: 25-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.5e-26
Family Prokaryotic proteases 0.0057
Further Details:      
 
Domain Number 6 Region: 976-1070
Classification Level Classification E-value
Superfamily TPR-like 1.97e-17
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158339401|ref|YP_001520578.1|
Sequence length 1350
Comment hypothetical protein AM1_6329 [Acaryochloris marina MBIC11017]
Sequence
MMQRTLSLLSLLVLSTTLCTSASAQPTHGSLPATHLAQAQSVDAITTYTQEITVRIRTNN
NQGSGTLISKQNNTYLVLTNQHILQGAKTIQIQTYDGQTHTATLVQNSFSSGYDLALVSF
EGNQSYTLPELGNFTPRPGQSLASAGYAADSQQFQISTHPLQQILDQPLKGGYQLGYPGD
VKQGMSGGPIIETTTGELVGINGQSVSPVVDNYETVDGTSLNPETIQQLRQLNWGISLQT
VLAQIQPNILTAYGLPQPLVASTVKMARSQGWVADLEAKAKNISVRIDSSSGSNGSGVII
ARQGQTYTVLTANHVVCETANGSPPCLAQRYSVVTPDGQTHPINANTIRRQEGVDLAIFK
FQSEANFEIAAFGDYNPKTDDEVFVAGFPKVNQSEASWQFNGGKVFDKNRGFLEVASYRM
QQADNVISIPQASFWGGYELVYSSITYGGMSGGVVLDRQGQVIGIHGLAEGESETGNINI
QLGWSLGIPTSSVLGVMPKFNVDLNALQINTTAPATLSSLQQEEWQASVLKAQVPTSNAK
PEVWIERGNQLWRLEQHAEALAAFEQAIQFNPEFVHLAWYGKALVYRAQEDYSAAETALQ
KVVQLKPTYKPSWQLLSVVYRNLKQPKQALVAIEKGLQIKANDAQLLNEKYTVLGRLRRY
PEALATIDAAIAQAPRAAFYINRGVVLMWMDQFEASLATVNQALELDPRLAIAYTNRGVI
HQLLRRYDAALADHQQAIQLDPQDSYVYSGLGQLYLAERRFEQALAQFKKGISIDPENTT
HYSGQGHVYFGLKRYEDAIAAHTQAIQLEPNLPSHLSSRANIYLLRQQYENAIADWSKAI
ELDPQNPTYFQGRGEAYAGLNQPKAAIADFSQAIQLAPRDVQSYTGRGQAYQSLQQYEAA
IANFNQAIKNADYPQATAVDNQYIQQKKGFAYTARGYLHVELEKFEQAIADFTQAIELRS
NSDNPNGIPLAKTDNLHNIRAISYINLKQYDKALADYTKAIEIAPQNPKYRVSRGQLYQK
MGREAEATADFQTALKTEPKDSEGYRVRAGINKSLKRYSEAISDYSKAIELAPQNGLRTS
ILYSSRARVHSELQQYEQAKTDFSQAIVLHPNPRSPYVSELFEARGRNFLNWQRLEGAVG
DFSKAIEINSKNILAYAGRGPIYLETKRYEQALSDFNTIIELNPQASPAYDLRSQTHRRL
QRFEEAISDASKYIELNPKQPVAYTKRGILYALTNNAQHALKDFKQAVELDEKAIIPTIN
MGLIYYEQEERNLAIAQFKRAMELDDKLAEPQLALAIALYHSGQQQQAIASAKFALTKDS
RLRDVEFLKQNLWGDQLIADAQQLFSDPAL
Download sequence
Identical sequences B0C7H5
329726.AM1_6329 gi|158339401|ref|YP_001520578.1| WP_012166436.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]