SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339402|ref|YP_001520579.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339402|ref|YP_001520579.1|
Domain Number 1 Region: 549-842
Classification Level Classification E-value
Superfamily TPR-like 5.82e-50
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Domain Number 2 Region: 936-1107
Classification Level Classification E-value
Superfamily TPR-like 2.34e-38
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 3 Region: 1043-1318
Classification Level Classification E-value
Superfamily TPR-like 7.59e-32
Family Tetratricopeptide repeat (TPR) 0.0041
Further Details:      
 
Domain Number 4 Region: 813-919
Classification Level Classification E-value
Superfamily TPR-like 1.07e-27
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 
Domain Number 5 Region: 45-260
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.32e-25
Family Prokaryotic proteases 0.0082
Further Details:      
 
Domain Number 6 Region: 279-419,448-505
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.31e-24
Family Prokaryotic proteases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158339402|ref|YP_001520579.1|
Sequence length 1346
Comment hypothetical protein AM1_6330 [Acaryochloris marina MBIC11017]
Sequence
MLRRFLPVLPFLVDLLPLLILSTAFRPAISATLPSTPNSSIVAPIAQANPDNTVNAYAQE
ITVRIQTHNNQGSGTLITKQDNEYLVLTNAHILRGAESLNIQTHDGQIYTAKAVENPFPA
KYDLALVTFVSNQSYTLPELGNFTPRKGQSVISAGYAADSQQFQVRPNQVQLILDQPLQG
GYQLGYPGDIQQGMSGGPIIETTTGELIGINGQSAFPLVDDYKTLDGQAIPPETVQTLRQ
QNWGIPLQTVLAQIQPNLLATYGLPQPLVASTVKTAQAQGWVADLEARAKTFTLQINSST
GANGSGVLIAKQDKTYTVLTANHVLCATPNGKPPCPLQQYAVVAPDGQIFKVDPQTVQRQ
EGVDLAIFTFTSDADYALATFGDYNPRKDDEVFVAGFPKVNQSEARWQFNGGKVFDKTDG
FLSVNSYSVRQNDAVFALPQANFGGGYELVYTSITYGGMSGGVVLDRQGQVIGIHGLAEG
ESETGNLKIQLGLSLGIPTSSVLGTLPKFNLSPELLQVSSTAPTPLSAGQQAQWQASVLQ
VDVPTGNAKAEVWIERGNQLWRLEQYAEALAAFDRAIQLNPSFVHLAWYGKALVYRSQEN
FPAAETALLKVLNLKPNYKPGWKVLSAAYRLQKKPEQALTAVNSGLKIAPTDAQLLNEKY
VVLSELYRYSEALAAIDAAIAQAPRAAFYINRGWVLIKMDRYEETLTALNQAIEIDPNMA
IAYTNRGVTYSFLKRPKEAIADLKKAIALDSQYISAYGGLGMLYHSQGRYQEALAQFNQG
IAIDPKNPINYSGQGFVYFAQKQYQDAIAAHTKAIELEPDSANDYFSRANVYITTQQYQD
AIADLTKAIRLAPPDPIYFNNRGDAYDALNQPEAALADYSQAIEVDKNNTRAYIGLGTVY
QRARQYQRAIAQFDKAIEVADFPQKLETDKKYKGLAYSARGFLYSDLGKLEQAIADFSQA
IELSPKVTYLYRARALNYTALNRYQEAIADYTQAIEIAPKDLSTYIRRGKIYRTLGQETE
ANADFQKVLTTEPSDSQGYGVRADVYKSLKRYPEALADYTKAIELAPQNPFQRSLLHSSR
AQMHGNLQQYEQANLDYSKALALLPNPTVPFAADLYIARGNNFLSWQRQDDALADFNQAI
GISPKNVMAYVGRGRLSLGTQKYQDALADFSTVIKLNPKLGFVYDFRSRTYQALNRIEDA
IADADQWIERQANAASYTRRGILHVLGANPSLALNDFQQAITLNPKAIIPTVNLGLIYYE
QGNRKQAIAQFQRAIELDGSLAEPQLALATALYHGGQQKQAIALAQSALKLDPKFQEVAF
LKQNLWGERLIVDVKKLLTEPAFQAP
Download sequence
Identical sequences B0C7H6
WP_012166437.1.67183 gi|158339402|ref|YP_001520579.1| 329726.AM1_6330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]