SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166363102|ref|YP_001655375.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363102|ref|YP_001655375.1|
Domain Number 1 Region: 628-978
Classification Level Classification E-value
Superfamily TPR-like 1.54e-69
Family Tetratricopeptide repeat (TPR) 0.00013
Further Details:      
 
Domain Number 2 Region: 905-1178
Classification Level Classification E-value
Superfamily TPR-like 4.93e-51
Family Tetratricopeptide repeat (TPR) 0.00073
Further Details:      
 
Domain Number 3 Region: 266-403,432-487
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.2e-30
Family Prokaryotic proteases 0.012
Further Details:      
 
Domain Number 4 Region: 6-250
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.93e-25
Family Prokaryotic proteases 0.0044
Further Details:      
 
Domain Number 5 Region: 526-639
Classification Level Classification E-value
Superfamily TPR-like 0.000000000011
Family Tetratricopeptide repeat (TPR) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166363102|ref|YP_001655375.1|
Sequence length 1179
Comment hypothetical protein MAE_03610 [Microcystis aeruginosa NIES-843]
Sequence
MLKPFPLLLSLLLLPVVPVKALSPFSAPAIVAEDSPNAQIERSIRQVTVKITSEINRGSG
IIIGKKGSIYLVLTNAHVIRGAKTLQIQTHDGQTRTASIVPNSLLKDKDLALVEFSDTRN
YPIAKISAIPLEAGLDITVTGYSAETGQYTTDNGKIEQTSDRPLREGYSVGYSGDIVQGM
SGGGIFFEDELIGLNGRSAHPILSNYIYEDGTKPTDAEIQQMRAVNWGIPINTLLTYIRP
EILSAYNLPLPQVNPDIETTAYTGYIAELETKAKGFTVRIDSSSKANGSGVIIAKKGNIY
TVLTAAHVLCEKIAEEKTCVNFTYTVVTRDGKTRNIEKSTIIRQEGVDLAVFQFESQDNY
PVAEIANYNPNSGDFVFAAGFPKIGNNPSKWLFSGGIIGGKEQGLLQTRQSDLSTQQSGT
LQSVASLTGGYELVYTSITFGGMSGGAVLDSQGRVIGIHGRSEGAGGGKIQLGFSLGIPI
STFMGLQERLKVKPQLLTTAQPQVSQQQKLEIIQAIDSIIVPNTNATADIWIERGGQLWR
LARHEEAIKAFDEAIKQNDPKNVYLAWYGKGLALGALDKDQPAIEALQQAINTLPKGEDL
KNFHSSILQRQSGVYRSLGDFSTSAGREREARENYEQALTVINQAISLLPNNPNYYNEKW
AVLDKLKRYDEGLAAITQAIDLAPRAAWYSNRGNLYIDLQKYELALSDWNKAIELNPNFA
DAYNNRGNLYKNLQKYELALSDYSKAIDINPKFAEAYVNRGNLYKNLQKYELALSDYTKA
IDINPNYAMAYNNRGNLYSDLQKYDLALSDYSKAIDINPNYAMAYNNRGVLYSDLQKYDL
ALSDYTKAIDINPNYAEAYVNRGVLYSDLQKYDLALSDYSKAIDINPNYAEAYVNRGNLY
KNLQKYELALSDYSKAIDINPNYAEAYVNRGNLYKNLQKYELALSDYSKAIDINPNDAKV
YYNRGNLYYNQQKYDLALSDYSKAIEINPNYAKAYYNRGNLYKNLQKYELALSDYSKAID
INPKFAEAYYNRGLLYYNQQKYDLALSDFSKAIDINPNDAGAYNNRGNLYSDLQKYELAL
SDYSKAIDINPNYANAYYNRGLLYYNQQKYDLALSDFSKAIDINPNDAGAYVSRSILYAI
LGQPEKVKIDLQQAAILFLQQNNMAAYEKVMQILQQLGG
Download sequence
Identical sequences B0JN19
449447.MAE_03610 WP_012264040.1.4043 gi|166363102|ref|YP_001655375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]