SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166363119|ref|YP_001655392.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363119|ref|YP_001655392.1|
Domain Number 1 Region: 1123-1345
Classification Level Classification E-value
Superfamily TPR-like 3.6e-52
Family Tetratricopeptide repeat (TPR) 0.00059
Further Details:      
 
Domain Number 2 Region: 688-853
Classification Level Classification E-value
Superfamily TPR-like 4.93e-48
Family Tetratricopeptide repeat (TPR) 0.00041
Further Details:      
 
Domain Number 3 Region: 971-1139
Classification Level Classification E-value
Superfamily TPR-like 3.41e-45
Family Tetratricopeptide repeat (TPR) 0.0005
Further Details:      
 
Domain Number 4 Region: 855-985
Classification Level Classification E-value
Superfamily TPR-like 2.16e-41
Family Tetratricopeptide repeat (TPR) 0.00036
Further Details:      
 
Domain Number 5 Region: 530-719
Classification Level Classification E-value
Superfamily TPR-like 8.22e-32
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 
Domain Number 6 Region: 272-419,448-501
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.44e-29
Family Prokaryotic proteases 0.011
Further Details:      
 
Domain Number 7 Region: 50-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.38e-23
Family Prokaryotic proteases 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166363119|ref|YP_001655392.1|
Sequence length 1379
Comment hypothetical protein MAE_03780 [Microcystis aeruginosa NIES-843]
Sequence
MIKPSIALILLFSLLPQPGLTLITPAAGNISNHPILTAQGDRELTEEQILQRVTVRITSE
TNRGSGTIIAKKGDNYLVLTNAHVTRNTKTLQVQTYDGHSRAARIVPNSLSENQDLALLE
FSDTRDYSIATIAKFTINQNRIGLEVVAAGYVAETGQYRTTKGTLEQVSDRPLRDGYSVG
YSGDIVQGMSGGGIFVDGELIGINGRSAHPILSNYTYEDGTKPTDEEIQQMRAVNWGISL
HTLLTYIRPEILSAYNLPLPQVNPDIETTAPTVYIAQLETKAKGFTVRIDSSSKANGSGV
IANGSGVIIAKKGNIYTVLTAAHVLCEKIAEEKTCVNFTYTVVTRDGKTRKIEKSTIIRQ
EGVDLAVFQFESRDNYPVAEIANYNPNTGDFVFAAGFPKIGDNPSKWLFSGGTIHDKEGG
LLQTRQSDLSNEQGGTLQSVASLTGGYELVYTSITFGGMSGGAVLDSQGRVIGIHGSSET
AGVGKIQLGFSLGIPISTFIGLQERLKVKPQLLTTAQPQVSPQQQQEIIQAITGVIVPNT
NAKADIWIQRGGQLWRLERYEEAIKAFDEAIKQNDPKNVYLAWYGKGLALGYLGKYQTAI
EALQQAINTLPKREDLKNFHSSILQKQSVVYRYLENYEQALTVINQAISLFPNNPNHYNE
KYVVLSQLKRYDEGLAAITQAIDLAPRAAWYGNRGNLYYNLQKYDLALSDWNKAIKINPN
YANAYNNRGNLYSDQKKYELALADYSKAIDINPNDAVAYYNRGNLYYNLQKYDLALSDYS
KAIDINPNDAKAYYNRGNLYSDLQKYDLALSDYSKAIDINPNYAETYNNRGNLYKDLQKY
DLALSDYTKAIDILALSDYTKAIDINPNYAVAYNNRGLLYFNQKKYDLALSDYSKAIDIN
PNYAETYNNRGNLYKDLQKYDLALSDYSKAIDINPNYAVAYNNRGLLYLLQQKYELALAD
WNKAIELNRNLALAYLGRGGIYSLQQKYELALADYSKALEINPNLAEAYLGRGSIYSLQQ
KYELALADYSKALEINPNLAEAYLGRGGIYLLQQKYELALADFNKALEINPNYAMAYFGR
GELYYYQKKYELALADYNKAIDINPNYANAYNNRGSIYYNQQKYELALADWNKAIELDSK
LAMAYSNRGNIYNDQQKYELALADFNKAIELDSKLAMAYSNRGNLYYLQQKYELALADYN
KALDINPNLAEAYLGRGGIYYYQQKDELALADFNKAIEINPNLVEAYNNRGNLYYLQQKY
ELALSDYNKAIKINKNAWFAMMGIGLVKYEQGSISEAIKQWEKALIINNQSAEIQLALAV
AFYHQGEKDKALKLAESALSINSQLANIDFLKKILRTNKIFADVQKLLAHPELKNYVNQ
Download sequence
Identical sequences B0JN36
449447.MAE_03780 WP_012264052.1.4043 gi|166363119|ref|YP_001655392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]