SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269138004|ref|YP_003294704.1| from Edwardsiella tarda EIB202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269138004|ref|YP_003294704.1|
Domain Number 1 Region: 620-840,877-889
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 2.62e-85
Family Helical scaffold and wing domains of SecA 0.00000786
Further Details:      
 
Domain Number 2 Region: 5-228,368-415
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-83
Family Tandem AAA-ATPase domain 0.00000011
Further Details:      
 
Domain Number 3 Region: 416-618
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-59
Family Tandem AAA-ATPase domain 0.00000239
Further Details:      
 
Domain Number 4 Region: 227-368
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 7.72e-44
Family Pre-protein crosslinking domain of SecA 0.0000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269138004|ref|YP_003294704.1|
Sequence length 902
Comment preprotein translocase subunit SecA [Edwardsiella tarda EIB202]
Sequence
MLIKLLTKVFGSRNDRTLRRMRKVVEQINRMEPEMEQLSDEQLKAKTVEFRERLAQGAAL
DSLLPEAFATVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNA
LTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLSVGINLPGMAAPAKRAAYAADITYGTNN
EYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSELYIKVD
KLIPHLKRQEKEDSDTFQGDGHYSLDEKTRQVNLTERGLVLIEELLAGAGIMDEGESLYS
PANIMLMHHVTAALRAHALFTRDVDYIVKEGEVIIVDEHTGRTMQGRRWSDGLHQAVEAK
EGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTIVVPTNRPMIR
KDLPDLVYMTEQDKIAAIIEDIRERTAKGQPVLVGTVSIEKSETVSHELTKAGIAHSVLN
AKFHAKEADIVAQAGQPGAVTIATNMAGRGTDIVLGGSWQAEIAQLESPTPAQIEAIKAE
WQTRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSLEDSLMRIFAS
DRVANMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIY
AQRNELLDGGDVLDTINSIREDVFKVVIDSYIPPQSLEEMWDVAGLEERLRNDFDLELPI
TEWLDKEPELHEETLRERILTMAIERYQSKEEVVGSEMMRSFEKGIMLQTLDSLWKEHLA
AMDYLRQGIHLRGYAQKDPKQEYKRESFAMFAAMLESLKYEVISVLSKVQVRMPEEVEAL
ERQRREDAERLARQQQLSHLDDQSAAAQEMASQTGERKIGRNDPCPCGSGKKYKQCHGRL
NA
Download sequence
Identical sequences A0A0H3DQ89 A0A1D7V607 D0ZCL2
498217.ETAE_0646 gi|269138004|ref|YP_003294704.1| WP_012847517.1.79796 WP_012847517.1.82304 WP_012847517.1.83294 WP_012847517.1.91532 WP_012847517.1.93598 gi|387866738|ref|YP_005698207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]