SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284041991|ref|YP_003392331.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284041991|ref|YP_003392331.1|
Domain Number 1 Region: 31-279
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-38
Family Eukaryotic proteases 0.0012
Further Details:      
 
Domain Number 2 Region: 304-477
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000671
Family Viral proteases 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284041991|ref|YP_003392331.1|
Sequence length 542
Comment peptidase S1 and S6 chymotrypsin/Hap [Conexibacter woesei DSM 14684]
Sequence
MKTRTDARRVLAGVLMSMGAMSFAVEPPSADAIVAGVPAQATEGYNASFQRLESPRDDRH
VCGATLIAPRWAITAGHCTNWVDGKGNISGKGTVRAALTGSPVGWRLRLGSLNASSGGRL
VTVEQFVRKSRRLSSAADLALLRLARPVGATPAPLATRRPEPGTQALILGWGYTGAKGGW
GDFANAASYPRALREARTSVWPGRTCGLEPQESGLCVGGERGRPAPENMDSGGPVLAEQP
GRGVVLAGTVNGGNYTGRPGPAVYTDISAQLKWIRSYTSGQRTIPRDRPVEGPGLAGTAV
VDRCSAAVIRVQSSQPADHALLLTNGHCAERRPPRGKALGARKVQSIVTINGAAGNAIVR
TSTTRLLYATMTGTDVAVYRLASTYAQLAESGVRVLSLSERGPAAGDRLSLLSGTYQTTF
SCRVDAIVPTLREGGYEQRDAIRYGRSASCEPEPGTSGSPLLDARTGDVVAIHNTHNVGD
RRRCSVDNPCEVDPSGKTTAVKRRGYAQQTAGLATCIVPGSRLDLSNPGCQLTKPAERVS
TD
Download sequence
Identical sequences D3F886
gi|284041991|ref|YP_003392331.1| WP_012932009.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]