SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271969488|ref|YP_003343684.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271969488|ref|YP_003343684.1|
Domain Number 1 Region: 121-207
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000291
Family Eukaryotic proteases 0.058
Further Details:      
 
Domain Number 2 Region: 393-489
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000321
Family Eukaryotic proteases 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|271969488|ref|YP_003343684.1|
Sequence length 518
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MNTRAKRLVLPLGGALVATTMIGAPLASAAQAAPAPDVKSSSLTSSGNAKAIAGYWTSSK
LKSAKSYISDSTVSAKLTKTGAAKAAADGKPGTIAPTGEGGKSAGKSKNLNLPITVGKVF
FVDGKGQERWCSGTSVQSKYRNLVATAGHCVYDTDTNKPFDNFVFIPGYYQGKAPWGIYV
GAKVNTHDDFTVFEDYDYDYAFVNVYDGVKQQAEKEVDYKTYKAHIDKGGVGREDAKTVD
FETYDRWTQKGGLGKVENVSSEDEVGPQFKGALAVASEIDKWAWEKVDGDVYGLKDDKVT
LKGKTLDQEAWPKSGSKLESRVEPVTKSEYDAYKGSGYKKIDAKGNYTITHYYVVKYIKK
TASVKYVIFRHYITTVASAGRLGDNVGGQGFTWNQKLGKKVFTFGYPTAAHPDGNKPYSG
HTMKWCYGTTSAAPVVPAYKAEEHQAIKCAFTPGASGGPFLLQYKSSKRTGYLNGVVSLT
VDSDKNNRYDRVTTPYFNGETYGIYKHAANLWTGKLPG
Download sequence
Identical sequences D2AZ04
gi|271969488|ref|YP_003343684.1| 479432.Sros_8293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]