SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428298041|ref|YP_007136347.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428298041|ref|YP_007136347.1|
Domain Number 1 Region: 85-297
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.74e-27
Family Prokaryotic proteases 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428298041|ref|YP_007136347.1|
Sequence length 306
Comment peptidase S1 and S6 chymotrypsin/Hap [Calothrix sp. PCC 6303]
Sequence
MNKQSFALLFTGIIGAATLTLSVQAQTKQSITPKFISAKTGEFKLDGKGKPFIPDGLGRS
VKPDEGDSRGKPTGKDPRIPMLSKKYPWSAIGRVQGTTTDAESYHCTGTLIAENLVLTNA
HCIINPETGKMSTKIQFMPNVIDGKYEDVAEVEKVIYGTDFKKSSDISPKDWAIMKINQP
LGRKYGYLGVKPIPTSTLIKNPKSLFFVGYSGDFPTEQYQKYFTAGKGWTAGYEEGCSIT
GEENGFLLHDCATSSGSSGGALIGVIGGEPYILALNNAEAKNLRTGQDITNFAVKISTIE
QDLSQK
Download sequence
Identical sequences K9UZF9
gi|428298041|ref|YP_007136347.1| WP_015197025.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]