SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428299394|ref|YP_007137700.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428299394|ref|YP_007137700.1|
Domain Number 1 Region: 653-1019
Classification Level Classification E-value
Superfamily TPR-like 8.53e-57
Family Tetratricopeptide repeat (TPR) 0.0035
Further Details:      
 
Domain Number 2 Region: 1034-1229
Classification Level Classification E-value
Superfamily TPR-like 1.41e-41
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 
Domain Number 3 Region: 39-256
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.05e-35
Family Prokaryotic proteases 0.0046
Further Details:      
 
Domain Number 4 Region: 276-486
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.41e-31
Family Prokaryotic proteases 0.0013
Further Details:      
 
Domain Number 5 Region: 1468-1655
Classification Level Classification E-value
Superfamily TPR-like 5.06e-29
Family Tetratricopeptide repeat (TPR) 0.0058
Further Details:      
 
Domain Number 6 Region: 1668-1777
Classification Level Classification E-value
Superfamily TPR-like 6.24e-27
Family Tetratricopeptide repeat (TPR) 0.00091
Further Details:      
 
Domain Number 7 Region: 1239-1472
Classification Level Classification E-value
Superfamily TPR-like 2.5e-24
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 8 Region: 511-635
Classification Level Classification E-value
Superfamily TPR-like 4.09e-23
Family Tetratricopeptide repeat (TPR) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428299394|ref|YP_007137700.1|
Sequence length 1787
Comment hypothetical protein Cal6303_2758 [Calothrix sp. PCC 6303]
Sequence
MKKPFILSLIATIGTLLFLPIATAQLSNSKSKSQTSALVTDQVSSENLRQIAQAITVKVY
AGDSRGSGILIAKNGQAYTVLTNAHVVNRGESSRIQTPDGKVYQARLINQGDSLKGNDLA
VLQIQATVNYRIASLGDSSALAENQEVYTAGFPFEQKNLSFTAGKISLIADKPLVGGYQI
GYTNETVQGMSGGAVLNREGKLIGVIGMGAAAILNDAYVYQDGTKPNETALAELRESSFA
VPIATLAKVAPQLIAIIPKPKPDNQETTANLTTYTGKVADVDKVNKIAQQITVRIDASKK
ENGNGSGVIIANEGQTYYVLTAAHVFKDSDQYTIVTHDGQQYPVQPTAITPLEGVDLAVV
KFQSQEKNYIVATLGDYDIILNKGQLIFVSGFPGVNTGTPKRILTAGAVFSQELTSVLTK
DPTTLTGGYELLYTNLSHRGMSGGPILDRLGRVVGINAASDNEYIQDQEVSVGIFSFGIP
ISTFLGRVKEVRIKIKPEDIKTFVPNEISETEVKAIFNQLLTLKHPLKDASEADWLNYGN
QLLRSGKIEDSLTPLNQAINLNPKLYQAYYLRGSILSFQGKSKEALAEFNKATELKPNFT
QAWRIKSSLLFNLKKYPEALKAIDKAIEIQSKSKSDPVGKIKSSFTFYPLRIAILIELER
YQEALDESKKFIDTSSYAIGYILRGAIYWKLKDYEKAFDDIKKAIELKPNNPNYYFIRGS
SYLERKENQKAFADFKKAITLQPSNAELYINRAIAYQEVKDTERAMADYKKAIELEPKNP
ERYITRAEAYQELKDTERAMADYKKAIELDPNNPERYITRARAYQDLEENEKAMADYKKA
IQIEPHDPWNYIWRGYAYQGMFRYQDALDDFNKAIEIDPKNPDLYNTRCSAYQEDDEQKA
ISDCTKAIELDSDNPKRYLNRAEVYFKSKNYQLKSKGFADLNKAIEVDPKNPNLYMIRSR
VYMNFFDYPNAINDATKAIDIIPSCFDCYFWRAFSYRQMKEYEKALVDYNKIIEIEPIDP
YSYNVRAEFFLELKDYKKAFADYQKMIELEPNNSENYLERAEAYWTLKDYQNAFADYTKA
IEVDSKNPERYLKRAEVYWTLKDYQNAFADYTKAIEVDSKNPERYLKRAEAYWTLKDYQN
AFADYTKAIEVDPKNPELHLKRAEAYWTLKDYQNAFADYTKAIEVDPKNPERYRKRAKAY
LEVKDYNKVITDYTKAINIISDNPTYYTDLKVLNNISDSPTYYIERGDVYSELKDYQNAL
ADYIKAIEIYDNLPALPNSQQAWLMHSTKKYKYEETRLKIVKTSLNYKDYQKAIVNLTKI
IQQNPNVFDLYFHRGSASLELKDNKNAIADLTKAIEIMEKEKNISSFAVKCTFSDLLCVK
EWSLYVNRGLAYKNQQDYLKAIKDFNKAAEILKYNRSNQEEYKRVQKYLIELASKNPEPY
LTKVEASQRSGDYKNMLANYTKAIEIAPQESEFYMGRANVYFLLKNYRKAFVDYNKAIAF
DSEKSWYYIERAEAYLKVKDNEKAFVDYNKAIEIYTKNIAKFSSISSFYYIDRAKAYLKV
KNYEKAFADYNKAIALEPDDDNNYIARAKAYLEIKDYEKAFADYNKAIADDNKAIAIQPE
PYAIQLELYNYLARAEAYLEIKNYEKAFADYNKANLEGNHFPYFIKITAYIKQAEAYLGI
KDYQNAIDNHTKVINLQPNNPIFYNSRGLAYFRSQNYQQSILDYNKALELQPDYADSYYN
RGLAYKELKDYQKAITDIQKAVQIYLQQDNQEGYQEAQNVLSNLQKL
Download sequence
Identical sequences K9V0U9
WP_015198362.1.40975 gi|428299394|ref|YP_007137700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]