SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428300429|ref|YP_007138735.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428300429|ref|YP_007138735.1|
Domain Number 1 Region: 401-622
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.19e-23
Family Extended AAA-ATPase domain 0.058
Further Details:      
 
Domain Number 2 Region: 11-179
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.24e-17
Family Prokaryotic proteases 0.0079
Further Details:      
 
Domain Number 3 Region: 203-328
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000119
Family Toll/Interleukin receptor TIR domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428300429|ref|YP_007138735.1|
Sequence length 710
Comment TIR protein [Calothrix sp. PCC 6303]
Sequence
MSWDLVKACTVAISNPAGDVRGTGFFVSQEGHLLTCCHVVEETGGWENVRVNGEAVELVY
LGNRNCDDFAVLKLPHYQGDAVPLSLDFQPMDRFLSVGYGRLDFPQGASIDGTITDVNPQ
LEFSNLPMLRLRVKANSQQVQGGYSGSPVFNAETQQVIGAIAAYDNSDGALAVPLSTVSQ
QWSNFSRFINILPVVPPLPASEIKRVFISYRSEDPDLSLAQNFYEEIRNAGHQAFMAGES
IRLGENWAKRIDRELESCDYFLLLLSSKSATSEMVTEEVRRAKELQDLRPEKKPGILPIR
VNFPISSPLNYDLRGYLNQIQQREWKSSADTAKILQEVLTLLAEENPSPNLSPTGEALKS
CMIESLENPPLPVAEPELPEGQVDLASVFYVNRDRIEERCYEAIIKPGSLIRIKAPRQMG
KTSLMARILYHASQNGCLTVPLSFQLADGKVFTDLDQFLRWFSASVGRRLKLSNKLADYW
DEIFGSKDNCTAYFEEYLLTEINQPLVLGLDEVDLVFQHPEIAADFFGLLRAWHEDAKNR
DIWKKLRLVVVHSTEVYIPMNINQSPFNVGLPIELPELNPEQVQDLAQRHGLNWSHTEIE
QLMAMVGGHPFLVRVAMYRIARRDNTLNELLQTAPTEAGLYGDHLRRHLWNLEQRPDLAT
AFKRIVTVTTPIRLDSIQCFQLLSMGLVHLQGNDVTPRCDLYRQYFRDRL
Download sequence
Identical sequences K9V3T3
gi|428300429|ref|YP_007138735.1| WP_015199388.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]