SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428302096|ref|YP_007140402.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428302096|ref|YP_007140402.1|
Domain Number 1 Region: 251-375
Classification Level Classification E-value
Superfamily TPR-like 2.01e-41
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 7-196
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-27
Family Prokaryotic proteases 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428302096|ref|YP_007140402.1|
Sequence length 375
Comment hypothetical protein Cal6303_5552 [Calothrix sp. PCC 6303]
Sequence
MRNFTILSAALIGTSIVLIQPYIAVAITQQEVEQIAQQITVQIVDAQNSYNSGSGVIIKQ
VGNTYTVITSYHVVDRGKKNIITPDKQSYQIKNIKQLNKLDLAVVEFSSNQKYTVAKIGN
SDKVEKQNIVYVAGFPGKTAAAPNVDFKIKDGKVDAKGTQDDGYDIGYDNRTSRGMSGGG
VFNEQGELIAIHGIAITEPSEENPEEKVISGALGITIYSALRQLVAVGVDVGVKPPDVVA
VAPNADDFLIKGNEKSSNKDYRGAIADYSEAIKLDPNYADAYYGRGIVRSKLGDKQGAMA
DYTQAIKINPNLDVAYHNRGVVRSKLGDKQGAIADYTQAIKINPNLTEPYNNRGVVRSEL
GDKQGAIADYNQAIK
Download sequence
Identical sequences K9VB09
WP_015201037.1.40975 gi|428302096|ref|YP_007140402.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]