SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187251074|ref|YP_001875556.1| from Elusimicrobium minutum Pei191

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187251074|ref|YP_001875556.1|
Domain Number 1 Region: 3163-3365
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000061
Family Prokaryotic proteases 0.067
Further Details:      
 
Domain Number 2 Region: 1408-1793
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000000235
Family Glycerol-3-phosphate transporter 0.042
Further Details:      
 
Domain Number 3 Region: 3799-3960
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000007
Family Prokaryotic proteases 0.034
Further Details:      
 
Domain Number 4 Region: 2307-2491,2549-2728
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000000759
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 
Domain Number 5 Region: 2890-3074
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000521
Family Eukaryotic proteases 0.068
Further Details:      
 
Weak hits

Sequence:  gi|187251074|ref|YP_001875556.1|
Domain Number - Region: 3529-3633
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00027
Family Viral proteases 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187251074|ref|YP_001875556.1|
Sequence length 3965
Comment hypothetical protein Emin_0664 [Elusimicrobium minutum Pei191]
Sequence
MNLGDRLTKIISGVLIITILHSVIPSEAYAQLKITKKQSEKINLQNNNAARKAVNSISVI
TDAKSLTNGPQSVKGLIGREISEELGKVWGKSFAVESVRVERVYEEERVKIAIESGSRER
RVYEVMGEDYYKALEYFAEQGGVRLGYGNDVEGESVEEGGLLNSADRVYSAYKRTLQNSD
SRKVGKGVIELRYDLIRKDSRKKLEMDIDEATGAMLKVLVDILLYSKRGIQERYAPLVTE
VLVGMRRLDLGGKTAGSMRAYYKEVLDVKKSKGVCESRITDGYVRGLGEAQKSCIDITSA
MTGLGLIGGGEEEIYKFGKEYWSEGRVSSVIMSRAAHGLILSGEKGIVLLGELIRETVRS
GYPRNAVKWAWDKFGAVFTPSEYVDGYYNHVSKKALYLNEVTRRFEYIDEEKAREWGFSV
RDIKMCQEVEVKRGSDACLMMPMRNVFTDIGEDLAYLGGAGGKREIRKLLREERNLHWPF
IVGVLGSGAYEGDGGANEIRKVIAGTTYMDVTSGTDRKIKEAVGLKIGGFNADQLKRARE
YYNEKRLAYVLDIVVMIALIGNLAKSMSTFRVPRSVENCWRSLRGAGNAGKEVSVRGVRS
VKVAEQAAAMERVNAVKKVSGGVKGGVIEFGLEGVGGELKVVKGRIGGKLKISPVLEGTL
KVETKVKDLGLSVGGSGGGGTFSARPVVGKGIIEGGKGISLESKVTGAFRVMEGNKVAGG
VVEGEKVIVAARGTGSGVGRIGRVMGRAKNSFVHAKNKAVVYSMMVMLPMGSMTEAGSAV
KNISNVGKQISVMAEAGGVGVRTIEGGKLIRGVIAAGEVSKAMRSAEVVSGVSKGLDRAG
RIGKASKLGGIGAKRVGDTAKLFGIGSIIGRPAEAEGGSGPSSGTLERVYAQLVGVRAPV
SKEVSTKEFIKQELINMSGIGFVAMLAEELKIGREIRREYGKEGITAESMKKQWAAVEMT
RAEAVLDRAVEEGRELTDLENSAVAGYISNIHVNNQGYVEGEKGEWSLSNTPIAKAADDY
IKNKYGYEYKQDVESYKRVNGEGKEETVSRIINKRVEKITPAQEALEGTAAEPGTQMHHE
IPSVLGVRPAAAVRREALPVAAPNIRENGFFKPATERIGINVLASFGNWGFIAEKTVDIV
KSGVEKIKSNSRKNLTKALIYVLTFGVAMPHSTNPMILPSRRDEEIAAVAAQRRSEDKHD
EMIFTGWAEEVGQTLSFPESGTGVSRSLENVREITQREMNNIVVNTVQKTGHTKTVKNVS
NNKIFNLLLKRFTKITVIDSSEDIVVPQVAAPDTLSSTAGRMWIRGNITLGSGANKVKIS
VYDKGEKAVITLKTDKKIKLNSERNEMLYVNAKGELIIRSNKRGAQIEKVLINTSLVLNE
NGRISANKDFARELNEGVGLVNNKLAPLFGLFVIAGFGALATSTASLVVDAFNVEGYMGA
VIQSVGYAVPTFMSVKIAKQTLNNSLRKMVNWGLAISLGAMTLPMFFGFFGHLPNSLEIW
KLVPLGVSMLALGFGITTLEVASKPLFQASSSVGRYRTNVADAGFVKQVVGSIIGAGVVP
LAKSMGFDWSFLFPTYAVLTIMGLIAFNKWKTNTRTLGNVVNASAEPVKTKVSAMELFKK
DPLVKNAYFTFAAHMWLMSTVGFQFNLIAFDAVGYTYGLALATGAFTAPMMVSRYFVGKK
LGNKSPSIISNIVKKSSMFSLAGLLLVQVPYLPINVLGMAVTGWGVATISPVVQAYVTDV
REKYAVQVSGILSSTTIGSMIGVVASAVVGSYLVIGDLKTAFLIPTFLTWVIWSFGNKVA
KGKFEENFTIKKEQNNNNVLMSDPLLGLGKNFIGKDNNPALLNNLGQSIKKLWDNSIGLR
RRAAAFAISLGLLIPQAGADIFESNSVIISLRKETLTPFVLERRKSEEDKYTELFFDSSQ
NLPYGTINLNNEAYVATSTALDNIDNAPKAKTITSTVVNSEAVELIVSKTIYKNTRVNGA
YHDEITSLANVIEKEAVNKYFENKRKTSGIFNKVKNVFNGSTKDFNNRLYENIFTTSFIS
NVNKSDLPANVKDNLMISFDEVFSTVKISAPARMPDEEDFYGLPAFDNSNGYTKNVALFS
KAGDNEIQLPVNMSVSGSLNIKKGEKVVVTEKGKIHFKSSFKEYSPDFFFIKTQSENLKK
IIDKVAKSENKTRIKLEREGKTWILLKRDIKRTERPIYHQQGESLVKLPVAFEVDNNIVV
RNNEKLIIDDNSVLYAQTEDGKVRTITDFYVRLPKEFALSWADIFGSAEGVDVKDYMDLT
VKANYNKILPLYSAALITSNPSTAVIGDIKHSMHLPEYLAQMIPFFSYISAMFNVFLNPF
IKIYGKVKVLNVALGVTGLSFVGMVAAGFYGQASLGLEPASWRLAIMASSLLLAGVAGSW
GSSVTYPLVKENSETTEIAGSRMAGLQLFRSFGAMAFLLVPVALATGVNALDIGFLDFSM
SYPMFLAGTAVTIAMLRKSKLKNIKDQTMPEQIAKMQGQTYLKIIPKGSVAGLGFQGAKH
IWDTLKTQKSIQRVFWAASLFTGSEIATRAGASSLIKGSLVKLAGTGQANTMLDSGIIFL
QRFLDGGTLSLALTMLVNYMPAILVRTKIKQLIQTKVLTSNDVLVLAGGFAGAGLLVFAF
NGFSLLGLTGVMINVVGTCSFFSQLQNTTMDNHSKKWHDSIANVLGVTLIGGAVISPIMG
AVSTVSGSMMTGLLVPAAALIGAVVLLVPEMKKSNIMTAFATRKSRKQSISLELLKDFKN
KVGIYNWVTNYLKSNEGAAYFPLYAMRLKEELVTNQKYLEERGVDFSYFEDIDLSFIKNN
RPMHGNSGYLSMGGLNPDSIEKAGKALANFFKALYFLVFPAKHKPNVISYKDSKIKDALF
AFNASESSLTGFVFEYDGKVYGLTTAHGAYLTPEEFIISAFNGENYTVKKLLTGNSRLYY
ETSVVEGTQDWTLLEIPQEALTAFKPLKVSEKKVRRGEVLAGEGVIDEKFFGVDNIIVKH
VAKDNLVYTHNFTNSDGKHVRGNGFCGSPVFRLNPVTNEYEVVAIHNGSSNDRSYSYAVN
MQAVLSAIDKNILKKNDKQKFLIVSKDALQKPVSTPVDKFITLSDIEQVNTQSLSLGLKI
KRALKLSYSSNPFVFASKLTARIYKHLKMKVLKKYQRMVNPREARPRILPSNHKHIVLDK
NNAPYSESIFYIGDRRASGVVVKHNGKIFGLIAAHTEDGLSKIIHIVSADKQAFKARVVA
AGKSKTLKAGYPDISVLELSGDALKKFVPLELSAENILENEEVYSIGFLRGFRLLPIINR
KVLAVDEAKYITTPVFGKDATGYCGSALIKDGKLAGLHKGSYSDGLNSIAVKASVISDFL
EFLETGKDAGYKISLADGGIYKIPFSKVTKKSKLYSNLEKTSGLAAAKTALPYKNMAMSV
RNSYKKLVFSVESDIIKAVKEAESPRSVALKDMKYTQSIFRMPGGGSGFLVTHKGRTFGI
ADAVLSSKLSDFYEITDINNKKHYSMSVLIERYNAAQMGRPGFPFDYNNKVILDIMQEDN
SINALKFASSPAKEGDILYSLGFLDNGETYAVDNIITQESKGNNFFFSTPFTADKKDVKL
FAGAPLLNKQGEVVGVYGGIYKDEDGNERHYSLGLKKLKELFIFVSSQFQPEKYSSSKKN
RKNNSDDEDAPAHGPNVQKAKQANLAVKPQKTQANALSAEDAALLEKTHDILQRRRNGEN
VTLAHREEYDNIIADLQNKPMTAKEREKIYSVKYFMTKLFIGSKHNHPAFSRGFQPSVVP
AEDIKYKKSFFYVPSTGVTGTVIEYKGQVYAITVAHATVNMNRENLQMQTSDKKMYTAEF
VNYFINEDILLYKLSPEARAYFKPLPVYNGNIEELQKLYTVGYLRGHLYASDNRYVLKND
GNELITTFNFTGGKNGFCGAPLIIEDPVTGKPYLAGMHTGSFGRSESNAVAPKVIKEILE
KAAGK
Download sequence
Identical sequences B2KC92
445932.Emin_0664 gi|187251074|ref|YP_001875556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]