SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427739179|ref|YP_007058723.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739179|ref|YP_007058723.1|
Domain Number 1 Region: 546-819
Classification Level Classification E-value
Superfamily TPR-like 1.58e-34
Family Tetratricopeptide repeat (TPR) 0.0069
Further Details:      
 
Domain Number 2 Region: 41-219
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.83e-29
Family Prokaryotic proteases 0.002
Further Details:      
 
Domain Number 3 Region: 273-495
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.25e-24
Family Prokaryotic proteases 0.033
Further Details:      
 
Domain Number 4 Region: 799-873,970-1006
Classification Level Classification E-value
Superfamily TPR-like 1.42e-21
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 
Domain Number 5 Region: 863-954
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000021
Family Tail specific protease PDZ domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427739179|ref|YP_007058723.1|
Sequence length 1024
Comment trypsin-like serine protease with C-terminal PDZ domain [Rivularia sp. PCC 7116]
Sequence
MKPHRTYFRQSLALIACMGSLLMLPMAESLSISHGKVSAQQPTPQLSPQQIKQLAQSITV
KVSSGNNGGSGILLKKSGGVYTVLTNRHVLEPGKPIKLQTSDGKTHRGKVVQGVDFQGKD
LIQLQFSSNEKYKVAELGNLATVAINETIYAGGFPFETNPSETQGFVLTTGQVLLIAERA
LKEGYQIGYDNDIRKGMSGGPILNRYGQLIGINGIHAHPLWGNPYVYEDGSNPTEARRDL
MSRYSWGIPILTATSLASKSDSTKAQVPVSKLPPIANEVNNIAEKITVRIDVPNSPECSG
SGVIIAKKQNTYTVLTAEHVIREDVKCDRRVLSLVTHDNRSYPIQVNDNSVKTAPGSDLA
LLEFNSNQTYDVATLADYQQGQNIGFVFISGWIGSESNSSSPQREFTAGFLTPKELGLFL
AKNPLSLEYGYSLFYTNMTHKGMSGGPVLDTRGRVIGIHGKAEKQEIKDKAGRNRLIPLG
FSLGIPMSKFVSWAQQVGITSVLRVETSVPPALTKKERNDIRQALLQVKKLGDNADAIDW
LNYGWEVFLSNGSESEAIKAVDRAIQNKPDFYQAWYLRGLMNGLDKKSLKDFEKAISIEP
KFTPAWRIRGFTLFHLDQYPEALSSFEQLVKIDSKDVSANTFRSLILLSQGNFTEALDIA
NLAFANSRNPDAWMYLVRAFALVANGDSKRAMANLDEAVRLNPEFMKGYVYSTRGNLRSQ
QGDLKGALADFNEAVLFEPEKVDYLKKRADIRSQLKDYKGAIADYTEAVRLNPKDSDAIK
KLLVIRIEQKDFNGAITDLNKFISLNPKNIDAIKARGVVRFAQKDYENALADFNEVIRLK
PDDSDSYYYRGQTLTQLNNYQAAVENYNQILHTEKFDGVIGINVEINSKTKVATVTQVKD
NYSAQKQGIKVGDQILVVDGKSTKNMSLKQVVDLLRGKAGTKLSVRVARSGNNKLDFNLT
RIELATTDIDAKFAKVYYQRGLTRIKLKDNQGARKDLQIAAELYNREGKKNEYQQALAKI
KELQ
Download sequence
Identical sequences K9RKX2
gi|427739179|ref|YP_007058723.1| WP_015121728.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]