SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427739440|ref|YP_007058984.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739440|ref|YP_007058984.1|
Domain Number 1 Region: 689-989
Classification Level Classification E-value
Superfamily TPR-like 4.36e-45
Family Tetratricopeptide repeat (TPR) 0.0027
Further Details:      
 
Domain Number 2 Region: 930-1151
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 3.4e-43
Family Protein prenylyltransferase 0.03
Further Details:      
 
Domain Number 3 Region: 543-709
Classification Level Classification E-value
Superfamily TPR-like 8.82e-38
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Domain Number 4 Region: 287-498
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.52e-29
Family Prokaryotic proteases 0.017
Further Details:      
 
Domain Number 5 Region: 38-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.05e-29
Family Prokaryotic proteases 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427739440|ref|YP_007058984.1|
Sequence length 1173
Comment trypsin-like serine protease with C-terminal PDZ domain [Rivularia sp. PCC 7116]
Sequence
MAAYKKNSWSLSKIACIGTLLILPVQGVYTTIHTQAALAQQQTSQLSQQQLQQLAKSITV
KILSGEKGGSGILIRKKGPLFTVITSKHVLEKNKSAFIHTSDGKKHQAELVKGINFDNKD
LVLLNFRSSDNYKVAQLGNSSTIKQGDKVFAAGFPFEANASESRQFVFRLGRISLLLKSP
LQGGYQIGYTNEVEKGMSGGPIISSQGKVIGINGIHAQPLWGNPYAYEDGTQPSDALQEK
MRNSSWGVPIQTVAKLAPQFVSGEIVASDPKNTSTNKSRLQQLSSQIDNIAKEITVLINW
GSGNGSGAIVAQQGNTYHVLTAQHVVRGNRTLTITTADGKQHSVNPSQIKILPGVDLALV
QFTNSEKYQVANLANYSLDINDRVAFVSGWPVPKAKTQKLSRQFSTGFLLGWNRGTNRAM
DDRSFSQGYGLVYTNFTALGMSGGPVLDTEGRLIGIHTAAEAFKKGQPSPIQQKSPRNPQ
LELGYSLGIPIRTFLAKIEQEKINLNLKPVANSLPKQLTAAEQDEIVQASLNLKPPQSNA
DQIEWLNYGNELWRSRRYKEAQSAFERSTKIKPDFYHGWYSHGMALMRQEKYPEAIKSFK
LANKYNPESDRALRQLGDAYWYSGEYPEALQTFKQTIQLRPDDFILHNWLADAFNQLGRH
PEALQAGNQSIQLNPNLAESYIRRSRTRSNLGDYSEAIKDLNKALKLQPDLAIAYVQRAL
VRYWQKDYQEALNDTKTAIRLQPNFVDAYWVSGLVHAQMNNREGFIKDFNKALQIQPDNA
VIYAQRGYAHYLLGDTAKGIADYNDAIRLNSKLAYEFYTQRGDIRWIQKDYNGAVADYTQ
ALSFRSSHVPAYIGRGKAYAKLGKRQQSLQDFNKALSLQPKNSLIYSSRGYSRLLLKDYQ
AGVEDYNKAIGLTPQLAYLFYNNRGNAQYEQENYKGAIADYTKAISLKPKDAVFYWNRGD
VYLTQKQYQQAIADFTAAIRLNPDYASAYNKRGIALEHGKDYKGAIADYTKAISLEPNQG
VFYSNRGGVYLTQKQYQQAIDDFTAAIRLNQENASAYSIRAIARDMQEDYKGAIADHTEA
IGIKPKEARYYNRRGNTYLKNKEYRKAIADYTTAISLDVDDGDAYGLRSLAYAGLGDKQK
AIQDLQKASQIFQKKGNMDNYKLVQSMLSKLQQ
Download sequence
Identical sequences K9RMX7
gi|427739440|ref|YP_007058984.1| WP_015121989.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]