SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ABX80912 from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ABX80912
Domain Number 1 Region: 11-165
Classification Level Classification E-value
Superfamily YutG-like 1.14e-47
Family YutG-like 0.00000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ABX80912
Sequence length 178
Comment pep chromosome:ASM1878v1:Chromosome:299539:300075:1 gene:ACL_0288 transcript:ABX80912 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pgpA1 description:phosphatidylglycerophosphatase A
Sequence
MIEKTYEEIKYDLIIKRLKERGVEVADIAKITLDLQKPYLKDMTLEICIDHVNRVLIKRE
VQNAVLTGIELDVLAEKGLLSEPLSTILMEDYGLYGVDEILALSIVNVYGSIGLTNFGYV
DKLKLGIIKELDTKQEGVVRCNTFLDDLVGGVAAAAAGSIAHKYADTTKVLEAYKKAI
Download sequence
Identical sequences A0A2G7QLG4 A9NEY2
441768.ACL_0288 ABX80912 WP_012242243.1.15573 WP_012242243.1.20474 WP_012242243.1.58935 WP_012242243.1.71135 WP_012242243.1.72193 WP_012242243.1.73551 WP_012242243.1.92431 gi|162447156|ref|YP_001620288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]