SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ABX80948 from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ABX80948
Domain Number 1 Region: 14-167
Classification Level Classification E-value
Superfamily YutG-like 4.84e-38
Family YutG-like 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ABX80948
Sequence length 192
Comment pep chromosome:ASM1878v1:Chromosome:336358:336936:1 gene:ACL_0326 transcript:ABX80948 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pgpA2 description:phosphatidylglycerophosphatase A
Sequence
MSKPKLLYNRDEMLKINIDTLKNRCNVSVLDIAKIAQQQQSKYYPGIDINLCVESVEKIL
TFRDVFHHIQFAAEVDRLAEEKMFKGPIQDILFYDLGLFGIDETIGLDVARNYGAIGQTN
FGDIDVNKHGIVKRLNDAGKTEGIVHTMMDDIVGAIAAAASTRVAQVMNEDIALENPSYQ
KISLFDLKKRKR
Download sequence
Identical sequences A0A2G7QLC3 A9NF18
WP_012242279.1.15573 WP_012242279.1.20474 WP_012242279.1.46366 WP_012242279.1.58935 WP_012242279.1.71135 WP_012242279.1.72193 WP_012242279.1.73551 WP_012242279.1.92431 ABX80948 441768.ACL_0326 gi|162447192|ref|YP_001620324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]