SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Astpho1|17676|gw1.00038.328.1 from Asterochloris sp. Cgr/DA1pho v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Astpho1|17676|gw1.00038.328.1
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily SBT domain 3.92e-27
Family SBT domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Astpho1|17676|gw1.00038.328.1
Sequence length 65
Sequence
VCQVEGCGVNLTGLKEYHQRYKICEHHLKVPELVRHDVRQRFCQQCGRFHHLVEFDGEKR
SCRAR
Download sequence
Identical sequences jgi|Astpho1|17676|gw1.00038.328.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]