SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434408355|ref|YP_007151419.1| from Stanieria cyanosphaera PCC 7437

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434408355|ref|YP_007151419.1|
Domain Number 1 Region: 763-1043
Classification Level Classification E-value
Superfamily TPR-like 7.59e-50
Family Tetratricopeptide repeat (TPR) 0.0009
Further Details:      
 
Domain Number 2 Region: 568-806
Classification Level Classification E-value
Superfamily TPR-like 2.65e-40
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 
Domain Number 3 Region: 300-412,445-523
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.46e-27
Family Prokaryotic proteases 0.018
Further Details:      
 
Domain Number 4 Region: 67-274
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.3e-26
Family Prokaryotic proteases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434408355|ref|YP_007151419.1|
Sequence length 1067
Comment Tetratricopeptide TPR_1 repeat-containing protein [Stanieria cyanosphaera PCC 7437]
Sequence
MKRSFALIGFFLLPTSVFTVSACSYLGINTSGAEDLTAKSVLTQSSGQQLAQSNEVAQAF
SPEAEKDLTELARAITVKISTKDNGGSGVLIGKQGNNYLILTNAHVVRGGKTFEVKTEDG
QTHQANLVSNSISSAYDRALLQFSSNHTYKIATLSKLPAEPELPTFAAGYSRQTGKFVTT
SGQVTQISDRLLKKGYQIGYTNEIESGMSGGPILDGDMKLLGINGQLKFPIINTVYVYQD
GTQPKPEEIEAMRQLSWGIPIDTVLGELNSNIVTAYNLPQPEIAEANTPALTEWLGELEA
EAKQFTVKIDNTNGLSNGSGVIVAKENNTYAVLTADHVICERDNATQPCRDFVYEIVTHD
GQRHQIEADKTRRQEGVDLAVVKFTSDENYQVAQLANYPLTQGDAVFVAGYPKLDNNKPA
PWLFSLGYGFEREQGLLEVKDSSLTTDNFGLISSQGSLAGGYEMVYSSITYGGMSGGAVL
DRDGRVIGIHGLAEGEEVLDSQSSDKKQVQSGFSLGIPINTFVGLTNILKVNSTLAIQDN
KPKKLNTSETQAFQDAILGTEIPQSNATAEKWIERGNKLWRLRRNSEAVEAFDKAIELKP
EFIHLAYYGKGLALGYERKYEAALKSLELATETEPSFAAAFLTKVVFLQQLNRLEEALSV
TETASSLQPNNANLYNQKGNILFDLERYSEAKLAYNQAIKLNPRSTFYYNRGNVYDQQNK
PDLAIVDFNKAISINSNDAKVYINRGLFYIRQDKPDLAIADLNKAISINSDYTKAYYNRG
VVYDQQGKLDLAIADLNKAISIDREFALAYLNRGAVYADQGKLDLAIADYNQVIDLNFDD
GIVYYNRGNLYAQQGKLDLALSDYDKAIAINSNYTGAYFNAKVYYNRGTIYAQQGKLDLA
LSDYDKAIAINSNYAEVYADRGSIYARQGNPDLALNDFNQAIDLNHNDGDAYYGRGTIYV
TQGQLDLALNDFNQAIDINHNDGDAYYGRGTIYLYQNKLDLALADFNQAILINPDDAKAY
GNLALVYQKKGAIEAARANLQKAQKLFIAQGNTVLAEQAASLLQQLP
Download sequence
Identical sequences K9XZU2
gi|434408355|ref|YP_007151419.1|NC_019765 WP_015211956.1.48393 gi|434408355|ref|YP_007151419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]