SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20002490m|PACid:23131248 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20002490m|PACid:23131248
Domain Number 1 Region: 24-72
Classification Level Classification E-value
Superfamily SBT domain 0.00000000000379
Family SBT domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Vocar20002490m|PACid:23131248
Sequence length 1604
Sequence
MNEDETTRRQPQGGSEFPPGNGQLCKVQGCQRRMSLEDTYYRRYSVCKDHLRALQLMVDG
RIQRFCQQLARHSLRRRLRLNERRLQREQLQRLQEQQQQQRQQPLHQRHQPPQDNPYEND
DDYDDDDYGSLTVAGVGRPEPRNSSRSAPRPRGGAGAGASASGPFQLPGAEDTAVDFGSR
GVLAAGMPSGHWTRRDHFADGHHQNFARAAASDGARGSASGSGGLFCLDLEHPRSQSLKL
AFCAPLGGDGGGANPRLGGSEDLDGLGGNSLQQLQQNPQQQQQKQEQEQGLRDQGKLDAA
APLAATQISLPETALRLHLNAMPALPLQRQQRPERHQSQPQQLLCGLLQGGDVRREPSAS
VDAMSMPPTQSGQKLMLGNKQQQQQLQQQQDPRQVRDPFAVWNVEQQEQPLQPLQQQQEE
LLQPPMLMSGAGGVERPHLTAADAFPRDPQLLTARSIVQDVRLERELVSLLGNLAAEQEK
LDDMYSKGTSRIAQIAGASGSGAWTTGSGGSDRVGLGSSSGSLVGPSSGSDLQSGPLVQS
GERESAHPDGDGDRLRTGRVRSGEVSAPGPASLPYLAAGGSDAAIASARATGMDWVPTVG
GGGGVESEYVNADGVLKEAARPGTSFWPTSAPIPSPFVQPGSSRGVFYGGGSGGGSGGHR
RSEQGIVGDVASPLGGPDSVVARQLEHPAQGNLSYNPLTATVCDTAKASLPLPYPPGTGQ
QQQQQQPSQQYLVADGNGGVPRLLRPPTGPQLLQGSAEEASGAPFPSPYRPEGGASSGEE
PAGVGAWPAVASLQRGFPTTSYPPQPQPQPQPQPQPQPSSLLHHPLGMEQQYSQQQHHYP
PPPPQQQQQQPPHAAALDHPTPAVMLPGLTPGRQLQPLQPLLSQQPPLPPSTTRLDEQLQ
HNQYNHLNQSQHKAQPAATLPGHVQQSASSLLGVGPHFQDNQQSHQHQQTHNPYHNLPSS
HSLPPVETAPNGPPPYGVVHSLSLPALYNPGRLLQRLSLKLHGCSPGDLMPDSRATLQSW
LTSMDLQMLQYTTRSGCILLIADVLVPVSCGAAAAPATNIAWSLLTRMVSDGPAAGGPGS
PCGGLAAATLQSPPPAEGMAGAVLSPNRSELPPSASVESSTSSSAALSYHEGTGARPGSS
KSSSGDGADADTDIGCGGHADSGDGSFSEAPTSKAASPTRCAIEHSPSGPDSRTVSNSGS
SGSREGERAATGGCGNGAGSPAASLSDEGLTGGEAVTGVATACGDGSGTAIGHPQDHYGP
PDTLPAAAAAAAAVPAAVPAFVRGAVDEPLASNAQGHMGPVSGSLCNLLRQLLGPLMAGP
GAAAEGAAATATAATNQRLVIQLDDQVLSLTWPPHLVDGRQAATSSGSDSGDVAGAGSDT
AISSAKSCPHVPRGGVAPPPPTLLGLRPAAVVAGRASSLRLTLRLSPLSRLARQEANRTA
ISADNYVAEETEAGRDWEQPAELHLRYGGDCLRCHWARRVQAAHPLLLWLHLLPPLPHSA
ATAMRSGVAEEINTLAELYDRWQLQPFLCDLGRLLMLSSAGSCLEEAGYTEDWLAYEAFS
ELRESMPDAAVAAGRLLQKCIEWRLPECTALVTSVFLGLMDGPI
Download sequence
Identical sequences Vocar20002490m|PACid:23131248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]