SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20003439m|PACid:23136690 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20003439m|PACid:23136690
Domain Number 1 Region: 103-180
Classification Level Classification E-value
Superfamily SBT domain 2.22e-29
Family SBT domain 0.00016
Further Details:      
 
Weak hits

Sequence:  Vocar20003439m|PACid:23136690
Domain Number - Region: 865-941
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000414
Family Ankyrin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Vocar20003439m|PACid:23136690
Sequence length 1131
Sequence
MADVFSTSFAAESHTAWAASQYAWDPSQLQALPLAASPASGSTGAASEHLSEGPCSSAGA
QRDQSLGPVPVGWQESTRAGAGGGNAGGKELKGAHTRAPKGPLVCQVEGCGHDLSLEKGY
YQRYRVCEPHMKLLSLVVNGKACRFCQQCGRFQELTEFDGNKRSCRARLLQHNARRRKRD
PLETSRKDVSGSRRSKTHHPWSDSSNDADMGHGSGDLSIGMNDKVMTNYSAESGVDQGIK
VRMGAAPVSSGGMTTWNVGINGAVETPAGVNQFQAMLQPPLAVHMHSGAVDADLARCFSG
GTDVGDALDEMLDGILNSKTDYLEDPRAALQAPGAVALPILGGAFGAAGSGLASGPVSGG
SLMSGPEVKPPQLGMMSLAMNSSPPLNSNNAPGRGFGGHWGTANMGNTVSMPEVMSGSMQ
LNSSMGHAAVGMNGIASGMSGMASGMATSGPLVAPPANAATPASSSFDLARRLVASGGAA
AQYQSEDLLVRVSIKIANCTPDQLPVDLYQRLRNLLNTADASLVQGFLRPGCTHLVLDVQ
VDRSARGNAGLDGFGDDGTGSVTIPGLAVSAMDVRKVLGPVVSRSALLVQMENEVAMWPA
GAPMGAKPHHSACVADLQASGQLPVIQHVSPAAYIDGAGRAALLVFGVGLCTPGVELCAR
IQGGYVPLTVKRLIEAGQVSVAAAADPKMAVATARAMLYAKALERAGRKCEDILLVFVEQ
APGTGLLFLEAQTGPLLGNWRPCVLSTDAVIAAELSLCAGRAVRAGAAAMASLEAFVLDL
GRVLDKRSYTTVVPRSQSAVTTEDRLACVDEAEECAIDLPKAQDSADDGQEFSEATLALV
CCCERLLATATDFSMARVSTFLAGALWQYGQDVQAILEAPYADGLAIVHRCVRSGSAEVV
SALLAWIAFSGARIDLANVGALGLSPLHLAALVPATWPVLAAVPAARKNWRSARSPLDGA
TPLHLQQMLLAQLPRGALPQDLVDAFAPKPRPVAVPGIAQGSGAITAIENTPSAVPAAGY
SGLAAIVSDGNSNGDKTRGDYRRARGAVVLMAIMFVVSVLGAMIPKRLWAPKASVNGEAV
PGAASAQRIFAGCCSTMMYVSLLGLAIQFLPLNKAGVLLSLFNPTATCLAP
Download sequence
Identical sequences D8UEY5
Vocar20003439m|PACid:23136690 jgi|Volca1|107563|estExt_fgenesh4_pg.C_700004 XP_002957226.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]