SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20005805m|PACid:23136442 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20005805m|PACid:23136442
Domain Number 1 Region: 388-465
Classification Level Classification E-value
Superfamily SBT domain 2.49e-31
Family SBT domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Vocar20005805m|PACid:23136442
Sequence length 857
Sequence
DDQTWAVEDWNWDPFNMFAAPKETPNVACCQALKRRKVDNTAAAQGQPQQQAQQGACCQG
PSGSIRAGGQPPAAAAACCSFTPNQTQAMQQLTGPLQAAMNSLAPQKAVVETCAVSSMCH
GPGAMVPPAAVPAAAPVAATGPQMLNVNMGMALPAGMGWAGLGDMSSPAASAAAAAMAAA
VDMPGFFTSMTGGTGRPLAGMGWGIQPMALQMPSMPMQPFPGSHAQCAPALSMPASGFPT
PSGVFQQQASMALPPSSVPSPALGSSGETSSLQGSADNAKALCCSGNRGGGGPTCSGGRQ
QADSSNKASMPLPNKAHQTGATGGRGADGAMVGGDLSDFAISDSEDEDEVGRRGPLGNNR
GNGAHHQQHQYLGDVIALHDVGDDNGLMVCQVPGCGKDLSGLKEYHQRYRICDVHIKLQQ
VMKDGRLQRFCQQCGRFHELTAFDGNRKSCRDQLSKHNARRRRRAQAEQAKGKSAAVDPF
AVGAVGCGAAAAANGGATASFDGDVGKLLTCLMQNPSQLHALRLLLGVPTHPALPASHPA
PGLGLGVGLGSGSPADSSSDGSDQARTYALARDIMGARNEFAPAFESEHRLIRLSMKLFN
RTPADLPSDLRNQVNSWLASAPAGMEASIRPGCVFLTVQMLVDEAGEAQAMAPGALGSLA
QHLLTRTGCPFWHTGMYTLQLHEDIMLVRDGRVSCDAASANGDGRFPVIRRLGPLAAVAG
QPVTLKLHGQHLDAPNCLVIVRWGAQHLKAHMQPLSAHRAIVRLPPLPELCGPVWVELMR
GAYLSPAKQMLVARNEALVEEINKLDVRYGPLSQETVELMLQDMAIVLQHIAGEQGAGAQ
LPHAAIALKVRHALGAA
Download sequence
Identical sequences Vocar20005805m|PACid:23136442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]