SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20005959m|PACid:23134758 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20005959m|PACid:23134758
Domain Number 1 Region: 730-808
Classification Level Classification E-value
Superfamily SBT domain 5.62e-26
Family SBT domain 0.00021
Further Details:      
 
Domain Number 2 Region: 28-137
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000761
Family BTB/POZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Vocar20005959m|PACid:23134758
Sequence length 836
Sequence
MPVLQLDNRREALAKEEAPCHLDLSKLIQSGTKTFFNNPALSDLTLVCPDGRALHCHSII
LAAASRRFAAALKQGNWTPGQQMPVKGVDSDALETLVCAFYTAECPLELGKVPALYDAAV
KLEVPSLAPALEQYLNSALQPHNCCQVLELCLSMGVSQLSDLVLAWIRGRVSDVVPSAEF
RSSRLETAACICKDLAHRSQLVGLQAAVSWLSASAPRSSLVGVFAEATGLTVDAIQAVAV
SGAALGPVGHGGSGGSINGLSGGLLQFSGHSGHVSHGIGHGGHGGGGASGLLGSGIAAAT
HPAAQSLNLSQALGPGGGGGGGAEGTLGGGSFGLSAGTGLGMAASNGGGGGSGTVQVLQL
LPTASGSQAAVLVMPSGNGNGGAGGISGESGHHTHGVHHHGLGVGGLQSLLTLHDGGGGG
KGGNGNGLGALGLGSGGGHSGGGGSAMGFGLDALADAAEGERVQKRLRGAGAGGPPCGGG
GGGGACVGPGMGIGGGGGFTAAAENMSGGGKRMNGLDDRPQHLPSGRMGPRDPNLALQQQ
QQAAAMNHHTGKQLQQYQPQSQQQQQQRGSKPVGSGRGGVGGRRRRAASASDDDEDYAPS
GGRSGAMNGGVGGGGCGVNGVGGGGGRARAQDFVYGAETLLDGPSAAGGGEGGGGVGGEV
GSDPGEDDAGGQNGGDDDVDTGGGAAGDVASPKPGGGAGSGGTSGGGGGSAQGGTPVLMT
GRRAPAQKGMCHVQGCHRSLQGLRDYYQRYKICEFHLKVSSVLKDGVPHRFCQQCGRFHP
LTEFDGDRRSCRTMLQRHCHRRAKQKQELAEVLAQRFEEKQVTMASCAAAMASRLC
Download sequence
Identical sequences Vocar20005959m|PACid:23134758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]