SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20007657m|PACid:23128884 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20007657m|PACid:23128884
Domain Number 1 Region: 111-154
Classification Level Classification E-value
Superfamily SBT domain 7.85e-17
Family SBT domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Vocar20007657m|PACid:23128884
Sequence length 158
Sequence
MGWVSEAVPWTPLTYERGPSPDVVVIDWSEAPPEPVRGFGDSRLLSFHLQKLGKRRRAAF
LHNDFGSREERLLSDAGPDPHPALLFHVSKSLALLHFPNLFCVIATLAGRSCKAYYRRFR
ICERHLKTLSLCIEGKLSRFCQQCGRFHGLEEFEGSKR
Download sequence
Identical sequences Vocar20007657m|PACid:23128884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]