SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20008278m|PACid:23126228 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20008278m|PACid:23126228
Domain Number 1 Region: 75-130
Classification Level Classification E-value
Superfamily SBT domain 2.22e-21
Family SBT domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Vocar20008278m|PACid:23126228
Sequence length 222
Sequence
MAFPFSQNVAEEEVTAVISSVVQQQALQEPCIGEEAAVKATAKTLAGRLRESDPSSDIDN
EQGARKSRSAQRRPLRCQVDGCGVDLTQARKYFQRYRVCERHLKSPSLQMDGRSVRFCDQ
CSKFHDIIMFEGNRSSRPAPLLPGADACRTCNEKLERTRQARSEKRRLHTVQTEGAASCR
WGPRRQGTAVLKRQHEADHDRDDNSDDDGDHSWVSGWGRVLQ
Download sequence
Identical sequences Vocar20008278m|PACid:23126228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]