SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20011002m|PACid:23132114 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20011002m|PACid:23132114
Domain Number 1 Region: 91-167
Classification Level Classification E-value
Superfamily SBT domain 1.09e-22
Family SBT domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Vocar20011002m|PACid:23132114
Sequence length 2662
Sequence
MKSVWINGLQRWHAMRAERHLSIGHLLVITAIEGAGCSVPKPGAEQPSDEHRSSSFQAQQ
QRHNQSIQEGDLRPSVMASATPVVQDTGANRCQADGCMADLSGLRRYFRRYHVCETHIRS
QVVHIGGREVRFCDQCSTFHPLAFFDGVRRTCRDKLEQNRMKRRARKQQNANHAGAITAA
ALAGAAAAASGNNNGGGGRSDDVDSDDQPANGGGPAAAAGGDDAGPAVRAQGGHSLARKR
QSGTLAQGARRLQPSARSVAAPDVTKAVKVQRATTGQLGAARAEVWSPESADEEPDMQTP
GPGDAGGGHHEDADWGAADMMTREAEMGLGGALGATLAAADGRDTGFGPAAATATATAKR
GRPWDPVGLAPDWPRVNHQDLRDQEQLQVAYGAVRDGAMYSPRGQLHGHLGQQGPQVQVQ
VRAQTVKVQPLQLVPPLSQHQQQHQHQQHQQHQQRLPMSEWEMETGGVIALERLPQGAVQ
GTWRLHGGSAPNLPQDSHALPDKSMHDGGMRLAAVGGPTNNGGYQVHVRTPHAANGAGYP
APNTLGDPGCARDGRVGLPSRVADQLITYKVDGEGAPAVTLLAQILRTEPEFRQQLPRTS
QAGPEPMSPPKITLHNGGGSGSADMLAGAAEGLTPAQQAALRLKLDAGLLASPPNATTAA
PQPQPPSSVSASAVPGPNMPKQWAQVQDDAPLQQQRHHHQPLVRHELPGYGTSRPGGQAA
TVWAGNGAAPQGSVWVTPDGTRFGAPLAAYPAPVGLGPQAVLIDRRISAGSSVYTADEEA
ALAMEDVTSLQMEAERAAIGTHNDALQQPIEEAPSLLDTPSFRDGIARDNADAQMWEARR
ELQKQQQQVQIVNVFGKLCDEQRPVYLPSAFRMHVPEDLDADSDYLQPQPQHAGIAAGAR
ASGRGPVAAVGRPAPLGGIGGGGGQRPPSPAPPQPHSWAGASSGWRYSNGDSGGAPAMLE
AQPQQQSASAIGYGTQQHMQQLGDSLAGVAPSDQELILSTLRKFAAHPPRAVKTAGGAHQ
QQQQQPDSMGLSPSMPQGRGPQDRGGDSGSGGSSGCGGTLHMLRAEEGRATQQQSYMQQQ
QQRQPPPPQQQPQQPAHNAAAGGEQLNLRRESSYNDNINGGPGSAEGLQQVLASEGLQSM
DSLAISEALLDGRGSLQLLDSVVFAQAQDAWVNTDTNPAAASGADCGPAAMQGGPPTPPP
HGSDGFTFGQGGRVAGEGERWMGSTSDSQVHARSWQQQGAAAGEGFSGEEWVELPGGGPG
MRVWERHQEQQHRHVQQHERGPSHGGMFPATERRPQHQQQQQQQQGYRPQSWNERHHHHH
HQQQQQQQQEGLRDGCRPGHALYTSPYDINRPLFGGRVTAEGSGGGGGGQTLSHVALKLS
HARPDSLPMELVERMQEAARGGGAAVLPATLREGCVEVLVEVMHSCPTSQLCNKLFGFPE
ASGGASSALDLELDSALATASGEQLRAWVGPHVFDSCERVTMQLLRGPVLDCKPGAPPKL
RRWEAAMQDAGLGFAAHWPEVLMLCSGPPVLVADAVNAQQIQLYGPAELASPQGVVQLCV
RMAGGAGSLGTVEAVAVDPEDGSSAPIPADQASTAAPAAVAEGWLQPTTSTTSCWAAARR
SPSPPVWPLAGPLSGLKAPVPGATSPALFRTVNASAGATNRLADLVAMAPRPTEQLKASP
SLATGPCPFYCFAVEEVSEAEGPSSLGMSSRELCVRKGTPPAAGSAPGCTKGTVSETTEH
PRSCFLTAPLPSSLPPSPPVAQQRQHRHQPGCLYNTIATAAATVARQPFSQLLLQQREQP
RQQLQLCCRPPTFHCRSKSDDGCMTLCGSNDSGGRHAGSPSPRVPALASKGESLGRHSTP
SAASHVCAGQPYGGGGAPLVSVTSATTGLVHCLGPLSRRVSLCSSATLTTAMTLHDRLSC
RSSATTAFTLGTTATLYDRLSLRSEWSWTSNMTSFGGMTAGAACGGGGINDGGVGGAAPY
SRTNEPQVSEPTYSVGASFGCTDQSLGPAHCARTARDDSKLEEENELMVSTPRRVAGPPA
SCSSPRAVTAASVAAQPYSSNSSDDASRSGGCCLRTGRLLDSAMVGLRPLRLQLPVLPCA
GLALLEATGGHAVAASWPLLVVETVSQRNELLALWRELADAGREDVWRELAADLGLVLGN
LPRRASVCDEPDPYLRSVPAAAAADRAFSSSALGSGEDFGFGGHGASAAVAPLRWRSLGT
PDRARDLLPGCYLNSGSLVSIESASQESWGTASATPRLATAGQAVNTGPVSCMATLVHQR
SSSSSDGDGSGSDVSRVGLPGSATSGASGDSGTSAVCVADQHTGAGLVAAATAAAGVGAV
YLAAGAPARSRDGPDAATVDGSHAVRGAGAAAGAPVSAFSSHMATTSFGVGVVGVGGVEE
AQEEGEGKGEQLQLPAVGRTCMLQRGDEVSLASGLAVIRGGCCDCDGEDDLHIASLTSFL
GDLRMTAGRRESSSDGRGRDDDAAARREGPGLGDGRRSNSSSQESASVLAAVESGTRAET
GDVAVGKGEQRKIGTAPKEVPGPPGLALPSPSPSLPVPPLAAVGLSAEARLALQAAVSRV
RRCIDARRLPALWELLSRVAVDARTGGNTEEEESTSEFSHMTIMLTVVLLLEWGGRARPG
RPAEFEGRLEWAERERTLAARS
Download sequence
Identical sequences D8U329
Vocar20011002m|PACid:23132114 jgi|Volca1|93794|fgenesh4_pg.C_scaffold_33000155 XP_002952986.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]