SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20011443m|PACid:23124502 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20011443m|PACid:23124502
Domain Number 1 Region: 30-136
Classification Level Classification E-value
Superfamily POZ domain 6.2e-16
Family BTB/POZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 484-508
Classification Level Classification E-value
Superfamily SBT domain 0.00000157
Family SBT domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Vocar20011443m|PACid:23124502
Sequence length 508
Sequence
MSSAKAGVLQLAPQTGEQAQCYIDLSRLLVTGTRSFYNNPTFSDITLVCPDGRQLRCHQV
ILAASSKRLASVLKQGGFTGSKLPVQGVDSDALDTLIDSFYTGECPLTLATAASIYDAAV
KLEVNGLPNAVEQFVSASLTPNNACLLLERAMGTKTGRLAEVCLQFIRSRLADVVPTLEF
SSANMDVVGQICTDVANNRHPPQLALQVAIAWLRGPPSGPSRTHLLPALADQIGISSDIL
QTYMRNSGNSPTAGGGGNGGGGGNGGGGSAAAVSLLGEPPSLDGSLSLSSLPLLQLLPAG
QLQQLGMGGGAAGAAAAQLLLGQGKGGAGTAALRSLLEEDGGGAAGGGGGAGVGSMEGAA
LAQRLGNLAGLRRDLEEGAAAAGGFAGALGSMSASGGGRGKRARTEDSRRNSGWEQEPLT
SSLGRGPSGDQLDMLLSPSGPGAGGGGGFGGAGGLGALLQGPQAAAYTADPPPRDRRTPQ
VKGVCHVEGCYADLTGLRDYHLRYKICE
Download sequence
Identical sequences Vocar20011443m|PACid:23124502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]