SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Vocar20014746m|PACid:23135630 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20014746m|PACid:23135630
Domain Number 1 Region: 45-94
Classification Level Classification E-value
Superfamily SBT domain 1.07e-18
Family SBT domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Vocar20014746m|PACid:23135630
Sequence length 124
Sequence
MENGEEPWNEDDYTFDRRRLTAQKKGGQLHTSPQSASSKPDVCCLGCHADLANSKAYYRR
FRICEAHMKSLSLSIEGRSCRFCQQCGKFHLVREVYDVWNCRKALMIRFYKRRNMPIGAN
VIPP
Download sequence
Identical sequences Vocar20014746m|PACid:23135630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]