SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bathy03g01690 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g01690
Domain Number 1 Region: 194-263
Classification Level Classification E-value
Superfamily SBT domain 6.93e-17
Family SBT domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy03g01690
Sequence length 1434
Comment chrom=[bathy_chrom_03] coords=[;305061..309365;] status=[complete sequence]
Sequence
MEDEMATLLLQNHLRSKKKTKTKTKKRNKGSSSPSWEVDEYEWDQVNCVGRMKNEMDSFS
SGGEESGIPEEEEEKKLSSSSPAFGRAEEKQQKKQRLEDDDEEKLSLFDLNTTKNNPLFV
GVSRGAREIEADERRFLIGQQQKGKNITIVASNEDGKRETRRNNNKNRNGGGSSANGSAK
VSSSSVANIKDKLVRCRVDKCEMMCERVYGKRSKVCEMHLKMDEVFHEGMLQRFCQKCTR
FHSIEEFKDKRRACALSLSKLAKVRAPNGVNGVGSSMMAAMAKRSGLNADRSEMTSFNGN
DEGYQQHVPFDALIAQAKSNLTTTKLSQRQNQLKQGEQQQRNSNTSNSKSTSLIRKEPSD
DSNTCGNNDNTKHHKYQRQEQNHHEQHQQQGQQKGQSTMRGFDVLDFAFPGMEEHDDAYL
NDFDSAGEPIRPQSNVLGLFSYDFTTGTLQNRSRTNLHKDAEGESTGGDFSIVQEGARKH
LEEIGSDTYSGDVDEFFERQQQQQKLYADKMTNFPDVHVSRAEIKISNRTPADISPAVGN
GIRQIFKDAAHIRVCAEPGCTKLTVDAVFPDIVRLKNGGSSVEINARELAQKAVDADRTL
DDVDASVTFRNQSATRKNGKWTVSDEKNSKMISFGRSLEAPWNAPFVICTNPSRNKKKNT
INNHKKGHQQHENKGNLFRISNIAENVVAHVRINGQILKDVKSLRRVGSDSSVLCFSVPQ
DYAEGVLSVDLVWSDEDSTHPDLVGKPAYDRFTTILTPDEKVADEIQSFITEVHSLSPRV
ARSLRTHFETIFAEDFRSESFERPMFREMVKDITSWSLRNSFSYTVERLFEAQKRALEEF
QLSRKAHTALATTCKTYLHSASLSGSSNLVKMVIIHGGDSDIFGSATTMVTLPNGSKECA
LHVASSDVFAHSSPLILELFLLGEENVRAFFTLKNSKGETSRDISSGHEPRGSLQHLYVQ
RCVQSALNVFWNVSKAIVDQYLTSIAMKHRLFTQDALSCWTDAYEEVCGNSSGIIDDMKT
NFVKDIAKSSKSTDFATITTAPVADTDEGDIDVLLEENNEGVRLSLELAKVLSSCDHVVR
EVCDRHFSHIRREMMNALNRPTARAIEEEEENNEKKEVRGSSEFQSREDGSPPRCADSFL
NDCFLHHRRKSRIRMELSTCAIHIETAARARITQVQNAWHRLADYVAGLAILSFDEPEME
KLYVHEDSTEKISTDLFVHLFYSLAIFIAYVRFYRANQLFGIIFFPSTCTQLFKKFVAIC
TLPALCYMNYFNPKFYVRHREAINVVSRILLSFLPSGNKQLENVIMPVLIVLKVVMFRMS
SALWPIRAERHACMVILGEILNPTCVSSILSVYAIIPMILNIYFCFIIELRQRRMFACKY
GCIWLNQRWSVYGSKSGKWTHSKRRGASKVYTTKRASTNTTTTTTTPTTSNYAR
Download sequence
Identical sequences K8EBS4
XP_007513950.1.44737 Bathy03g01690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]