SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bathy07g01100 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy07g01100
Domain Number 1 Region: 242-306
Classification Level Classification E-value
Superfamily SBT domain 0.00000366
Family SBT domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy07g01100
Sequence length 1106
Comment chrom=[bathy_chrom_07] coords=[;233779..237099;] status=[complete sequence]
Sequence
MSSKTRSSNRFRKNNTNNDSDDDDKKNNERTALKDGFGQRSSRERTHPHRHHQHRAKKKM
KKNKSGERVEEEEDIEGENNVLVVQQEVAGLKKINKDDASNSMTVLVRNPLFKRWTKDSI
AFDGRTFRVANESMRKEIDEKKEKKEKEEIRPLEKEEEKESQSKGVARRKERNGEEESRI
IPSHEQQTLSPREQKRFKLEEQRKAYNASINRGRKGRPRKGEMERNGAILCKMCENEQKN
EKGSKFRKYFCCDACVLRTSSTFVPSIGASVLFCQQCRKPHLKDEFEYGMKSCRESLNVH
RIARLKRAGKYDLSEGRRTSNGDEKATAERSSTAGERSARGCVATTRKKEEGGSFVCDSS
RDASEESLGEDIRKQQQNLDKEHVKSIGNAFRNERDQYTQEIGKYGLEQAAFDKALVGGS
TYNPVAKLVIPDISPDIFSVFPPALTKSDRLVFHAMRKTAYEAEMEVRRSWELNQASEDG
VHVKVQNASPPDLHPDLVHFVRDALRMEPLAIGDGGEEAAQSPRARTTDGKDFPHDNNSN
DLLGTVRPGCVSFSFWVSDPQVLETEFAQSIFHSGDNSLFNRLRAAFVKGVRNSVQDEKT
KATVVVERGRNSVSVRHRNIEIMTKVEKMIGDATKPQVFHVSARSVLSGYVASIAIIGAN
LLGENSYLNIKFNDEVQEVCLDPEVNTTLEYSILERDQHMNVTPVMIRTYVRFNKSAFSS
RNKKNTSNGGVDTALLSSVASLFQASSSKVKLATLQIVRDCNASEAEPIVVTTSKRIHRE
IHANFCSREDPQVMGTITRRAFLSCAKNCEDERVATGVVTKCTIDAMDALNLRALANELR
RLDRERFYVSIQKALANVCDPYAEILLSGFLFASAHKFYRKVRKIASPEACAKLRKKLFL
SHAPNIFFVAIMFLMYYSSVTRTSLYSKMRERFLLAMRIHAMFYGWFSIHAATSVVFESA
NATVDSDTKHLKLVENFRCPQLERFSGFIVVVVTAAIISLMHSARPTWDVTVKILHTALQ
VATAVCWQCTTGETIVMIVLVVSIQGILTVPMFWTQKRAWKGVWMAHPYQIRTQKAREVF
SVGGLANDATGEKKNAAVTRNTKKAD
Download sequence
Identical sequences K8FEN5
Bathy07g01100 XP_007512328.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]