SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bathy08g04030 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy08g04030
Domain Number 1 Region: 108-183
Classification Level Classification E-value
Superfamily SBT domain 0.0000000288
Family SBT domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy08g04030
Sequence length 449
Comment chrom=[bathy_chrom_08] coords=[;738239..739588;] status=[complete sequence]
Sequence
MSEDDDEERNELTLRRSLFEESDLLFSNQQPSTTVCRLASNPTNPSPPERVTTFTNTASK
KTTKKTKKKKTNDDKEEVQQQQQQQQQNPNNNEKSSRSSMENELVVKVACKVYACEEVCE
NKYQIRSKTCRSCLNAKEVFVEKGDEMASRFCQKCTKFHGVDMFEGGRKACKMSLKKVQE
KNKVIFAKQKMLLKEWEEAMTRRTTTTTTTTAVKRSTKAKKEKKKTKSQENLSEESKDRN
TITTSDTQTMNNRKTMILKPCTMDSLYSTDEGHESKAAAAGAPIVTKTMGRDQQQSWPAI
VAVNRVDRLLEAIKAEKRKESLLGLNLVKRRKRGEEEDEDLVMAAAREEEGRREEEEKEE
EEGIDDPMEGEEGEDDDERKEHTDNAKKPPKIKKLPSLVSNILVRSITPTLSGVVRSITP
TLYREAMESKLNEFRGLSSKLSPPPPPKD
Download sequence
Identical sequences K8EII7
Bathy08g04030 XP_007511710.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]