SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bathy10g00480 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy10g00480
Domain Number 1 Region: 200-267
Classification Level Classification E-value
Superfamily SBT domain 0.0000000000000419
Family SBT domain 0.00075
Further Details:      
 
Domain Number 2 Region: 762-896
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000218
Family Ankyrin repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy10g00480
Sequence length 1606
Comment chrom=[bathy_chrom_10] coords=[;72243..77063;] status=[complete sequence]
Sequence
MATTTNTNVESIFNNDDNTNNTKEEEEEEEEERERILPLNENEKDAAWALEEFKWDSDKA
IGEKITTLTTLKTGKKRVGGRGGGLKRKQTMGTEDGSNDDDDDEEEEEEEEADVNDLRNS
PRFRPMVRTSEEKEGDKNKYLEKRRKEEKNFTTDSADGTADDGARTSIAAAALATTGFVP
VKLRSEAANGTKYRVIKHKVFCKVNGCDEECLSLYSIRVKVCVFHLKADEVMFNNELCRF
CQKCTKFHNVGNFEEGRRACLRSLNRLAFKRVPASAQESALNTLALYDRMIMSQAGTGEA
APNGGANSDSATNTDNNKREVSSVLPSNELTRQRRIRDALTLLGASWHQGTRKKERKERM
TIKERNEEVQQQSQGTQIDQKTLSVSQLRVIRLQCAQMLLDHLPENFDPSTNAEERRRRE
IINASYTRSEGYDRLMHLDNEAFITLAAEIKIHNKQPHDLSASIGEGVKNYFAEKSGHPP
ARLEFTAEPGCTKLNVDALIPPMTSRHSFLRNRRGTSDKEVAKELASYAIDTDDGGLDDV
DIDVIIGAVRTRRRNGEWELSTKIRKKHDCRSAKHVMCTNPDILNSCENENTLIVTGVPP
DVVAVVRINGQVERGSVIARFGGNSPVTEASTRKTTTRLNQSSSESNQQQERPDVLQNSQ
SNYVYVSVPLDYAEGLMTINLIWPEGHEFAGSALCDPIIILLTPDVDLAQELKEAMDEVH
ALSSEFCYTFKRYVGACLVKDGDVRSFTNPNFCLVQKDITLWALRNGFPKLSKRLLKPQV
QMLENARSLAAADGVYKTYVYAATLSDSVEIVREVIALGGEKNLFGTVSTVGNKETRDTA
LHIAAMNGNTNMVLDFLSIVSSIESWFTSRNSSGFSPRDCAVLAQSSNLSKAIAKVLDDP
LLIASNAVCLAVKEFVSKVKSGAYTAPDHAPAIDHVEELENQSQAIFARASDLVFESLTE
ISTTVSQNELEEARKVATVRLLEITNMLLQHKACFLKLFSLAIERDCKLLESYNGADSMD
KSFDSPIQSGADSFFVELLSSYDSGQGRGYVPQSIRKIFGKLSNALASLKYKSMLAFEDP
LIEKAYVLENSFYRKRVDLVAFLLIFSVICARRIKFSDGTFSDFVFTFFRMGESSSLCFY
ISRMIGVLTFPGAIFALLVYPKFYTRHRESITMLVRYMSPLMWSLRSANETAPVSIARVM
FMRSSACVYGCRFERHAFVTMMNYFFPFARMLKIFEGQAADLTFSTVVEDLDRNGCNRIL
SMGSIGLNLVVSFLVEARFRRKFAAKYGVNWMKISWMTSPPLPPGEDEKFIKDIREEVGA
FDSDEEDDVSHKSLNRRNRFFKFISEQRKSLHAKAYFAFPNPRDEGACVLENSNFRRPYD
IAIFGYLYLIWGSELYRKYLKWGHSFDWYALSMFTKCDVTEDTMRITGYERRVSALFLLK
VFSSSVLVGTSLIAIFLPRVYCHSRESFIAVLKLSASVAPALKVAESPEFVVVIMFRLCA
VLLSVRFEREVMIVLTNAFIIPRALEWYVGTEEYGIIDVSGDSSVVTCKGNSGSLNLGIF
SGNWYKWSSFFKFVFVVLMYLQISIVLTLEKQRREAFARKRRIKQH
Download sequence
Identical sequences K8EJB8
XP_007510593.1.44737 Bathy10g00480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]