SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bathy13g00380 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bathy13g00380
Domain Number - Region: 135-215
Classification Level Classification E-value
Superfamily SBT domain 0.00746
Family SBT domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy13g00380
Sequence length 262
Comment chrom=[bathy_chrom_13] coords=[;155209..155997;] status=[complete sequence]
Sequence
MVEEPSSTLFPLPLSNHQHDQIHREELKVLFELADDHGFVDWLQPSSHAATSKRSGQKKF
ASTPCTSSFRTEEEEETRKKQKKKQKETKSDERKEREERKEKESSTTSTRTTTNTSTATH
STRVCGVLSPRTRRVCDCFGCEAICEKVRSVAAGGLHVCEMHKRKDSFLLKGRGEDMKFR
WCFYCHRPQKIEEFSPSSRSICKEKFALRKQRRKVKSELANKNKYFKEATAPTSLVFDDC
SAFDPMSFVMDECLNYDDDCLK
Download sequence
Identical sequences K8F368
Bathy13g00380 XP_007509462.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]