SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|442319598|ref|YP_007359619.1| from Myxococcus stipitatus DSM 14675

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|442319598|ref|YP_007359619.1|
Domain Number 1 Region: 87-120
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000758
Family Eukaryotic proteases 0.027
Further Details:      
 
Domain Number 2 Region: 89-126,209-315
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000245
Family Eukaryotic proteases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|442319598|ref|YP_007359619.1|
Sequence length 667
Comment hypothetical protein MYSTI_02619 [Myxococcus stipitatus DSM 14675]
Sequence
METTLRAAWFGASFHLSILGAALAACRPLDEPTTEEPGATPQQVQLAYRDYYDMAFSPGG
AMASSQLSRGTLFVPMRQPDTHELRLGLDGSPLRYTCGVTFISPRKAITAAHCVDDINVW
DPPHQPLEVQMYDPMVEADVKWEATANSLAGTFPRYRRTPLGPGYSTTSYQCRVVSRCGN
AYGTYNCPGNFPRADTALLDCGPASPGCRYDYLSVADHEGVGVPVSMAWAHEVYAIPDDR
RSDLWQHYTLYANYDPVQNYHYYPANQLLPLVSKPWSDPPRPTVSLGVTLVGTDARLTEL
HGCHGSSGSGITQLNAGLGTQELLGPVATWDKWVFTAHDYDFLCEDPDRTARKPGDGGLG
YARLAVTQKLAEGRSTTDVCGTEEPGLFPNPLLWLTHDIWILRKGMVGRQAFPKRWPCTD
TTCTAWERLRIVNEPLVPVARGETVTLPPANVVAGMTYRVSVRIRSLEGTPPLITLALGN
QTLLRGVRPVVHAAEAAGLVGIAFKATRGGSQTLQISAAQGSGAFAVTEITTVADPLANG
FEYRSQRVGMGIVEPGTRTPVPATWTRMGSSGFAARVKGGQRFLVTRQAFIRGRTWRVEF
DTSRDVTGATCGFITSDNRELRMRCNSVSRHILAHFNLGDAQPVAFFVDLPKGQPDLALD
NLRLETR
Download sequence
Identical sequences L7U833
WP_015348196.1.99865 gi|442319598|ref|YP_007359619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]