SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCJAP00000006670 from Callithrix jacchus 73_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006670
Domain Number 1 Region: 335-529
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-61
Family Hemopexin-like domain 6.99e-06
Further Details:      
 
Domain Number 2 Region: 110-298
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.75e-44
Family Matrix metalloproteases, catalytic domain 5.16e-05
Further Details:      
 
Domain Number 3 Region: 57-120
Classification Level Classification E-value
Superfamily PGBD-like 4.08e-15
Family MMP N-terminal domain 0.0073
Further Details:      
 

Protein sequence

External link(s) Protein: ENSCJAP00000006670   Gene: ENSCJAG00000003654   Transcript: ENSCJAT00000007043
Sequence length 610
Comment pep:novel chromosome:C_jacchus3.2.1:9:122891676:122913646:1 gene:ENSCJAG00000003654 transcript:ENSCJAT00000007043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGRGSGPPPQGPSYGRHPPTCCGQEMLNLKWGSRGVKAPDSPAPQTCPKIVSLHVEEW
LSRFGYLPPADPTTGQLQTQEELSRAIAAMQQFGGLQATGVLDETCMVMMRTPRCYLPDL
SVLTQTCRRRLTAAPTKWNKRNLSWRVRTFPRDSPLGRDTVRALMYYALKVWSDIAPLNF
HEVAGSAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPSDHHTAGDTHFDDDEAWTFRSS
DAHGMDLFAVAVHEFGHAIGLGHVAATRSIMRPYYQGPVGDPLHYRLPYEDRVRVWQLYG
VRESVSPTAQTEEPPLLPEPPDDRPSIPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFW
RLTRDRHLVSLQPAQIHRFWRGLPLQLDSVDAVYERTSDHKIVFFKGDRYWLFRDNNVEE
GYPRPVSDFSLPPGGIDAAFSWAYNDRTYFFKDQLYWRYDDHTRRMDPGYPAQSPLWRGV
PSTLDDAMRWSDGECTTLRGQEYWKVLDGELEAAPGYPQSTARDWLVCGDSQADGSEAAG
VDGAEGDRAPPGQHHQSRSEDGYEVCSCTVPSGQPSPQTAPPARCCGTSLFLMVYPLCPH
FLWLFRGCSL
Download sequence
Identical sequences F7GVH4
ENSCJAP00000006670 ENSCJAP00000006689

Jump to [ Top of page · Domain architecture · Domain assignment details ]