SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCJAP00000006670 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006670
Domain Number 1 Region: 335-529
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-61
Family Hemopexin-like domain 6.99e-06
Further Details:      
 
Domain Number 2 Region: 110-298
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.75e-44
Family Matrix metalloproteases, catalytic domain 5.16e-05
Further Details:      
 
Domain Number 3 Region: 57-120
Classification Level Classification E-value
Superfamily PGBD-like 4.08e-15
Family MMP N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
cytokine receptor binding 2.034 15.08
growth factor receptor binding 1.996 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.82
clathrin-coated vesicle 1.877 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74

Protein sequence

External link(s) Protein: ENSCJAP00000006670   Gene: ENSCJAG00000003654   Transcript: ENSCJAT00000007043
Sequence length 610
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:122891676:122913646:1 gene:ENSCJAG00000003654 transcript:ENSCJAT00000007043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGRGSGPPPQGPSYGRHPPTCCGQEMLNLKWGSRGVKAPDSPAPQTCPKIVSLHVEEW
LSRFGYLPPADPTTGQLQTQEELSRAIAAMQQFGGLQATGVLDETCMVMMRTPRCYLPDL
SVLTQTCRRRLTAAPTKWNKRNLSWRVRTFPRDSPLGRDTVRALMYYALKVWSDIAPLNF
HEVAGSAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPSDHHTAGDTHFDDDEAWTFRSS
DAHGMDLFAVAVHEFGHAIGLGHVAATRSIMRPYYQGPVGDPLHYRLPYEDRVRVWQLYG
VRESVSPTAQTEEPPLLPEPPDDRPSIPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFW
RLTRDRHLVSLQPAQIHRFWRGLPLQLDSVDAVYERTSDHKIVFFKGDRYWLFRDNNVEE
GYPRPVSDFSLPPGGIDAAFSWAYNDRTYFFKDQLYWRYDDHTRRMDPGYPAQSPLWRGV
PSTLDDAMRWSDGECTTLRGQEYWKVLDGELEAAPGYPQSTARDWLVCGDSQADGSEAAG
VDGAEGDRAPPGQHHQSRSEDGYEVCSCTVPSGQPSPQTAPPARCCGTSLFLMVYPLCPH
FLWLFRGCSL
Download sequence
Identical sequences F7GVH4
ENSCJAP00000006670 ENSCJAP00000006689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]