SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006811 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006811
Domain Number 1 Region: 36-199
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.47e-57
Family Matrix metalloproteases, catalytic domain 0.0000002
Further Details:      
 
Domain Number 2 Region: 208-281
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.71e-24
Family Hemopexin-like domain 0.0000854
Further Details:      
 
Domain Number 3 Region: 1-30
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000133
Family MMP N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSCJAP00000006811   Gene: ENSCJAG00000003743   Transcript: ENSCJAT00000007194
Sequence length 305
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:407831:420043:-1 gene:ENSCJAG00000003743 transcript:ENSCJAT00000007194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRFFGLNVTGKPNAETLEMMKQPRCGVPDSSDFMKTPGDPKWEQTDLTYRIINYTPQLS
ETEVERAIGKAFKVWSDASPLTFTRISQGEADINIAFFQRDHGDNSPFDGPNGILAHAFQ
PGRGIGGDAHFDAEETWTNTSKNYNLFLVAAHEFGHSLGLSHSSDPGALMYPNYAFRDPS
TYSLPQDDINGIQAIYGPSSKPIQPTGPSTPRACDPSLTFDAITTLRGEIFFFKDKYFWR
RHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLVFLFKDMITKGNSWNQVIPKAQQKS
FRNRK
Download sequence
Identical sequences F7DGQ3
ENSCJAP00000006811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]