SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCJAP00000006811 from Callithrix jacchus 73_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006811
Domain Number 1 Region: 36-199
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.47e-57
Family Matrix metalloproteases, catalytic domain 2e-07
Further Details:      
 
Domain Number 2 Region: 208-281
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.71e-24
Family Hemopexin-like domain 8.54e-05
Further Details:      
 
Domain Number 3 Region: 1-30
Classification Level Classification E-value
Superfamily PGBD-like 1.33e-12
Family MMP N-terminal domain 0.0014
Further Details:      
 

Protein sequence

External link(s) Protein: ENSCJAP00000006811   Gene: ENSCJAG00000003743   Transcript: ENSCJAT00000007194
Sequence length 305
Comment pep:novel chromosome:C_jacchus3.2.1:11:407831:420043:-1 gene:ENSCJAG00000003743 transcript:ENSCJAT00000007194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRFFGLNVTGKPNAETLEMMKQPRCGVPDSSDFMKTPGDPKWEQTDLTYRIINYTPQLS
ETEVERAIGKAFKVWSDASPLTFTRISQGEADINIAFFQRDHGDNSPFDGPNGILAHAFQ
PGRGIGGDAHFDAEETWTNTSKNYNLFLVAAHEFGHSLGLSHSSDPGALMYPNYAFRDPS
TYSLPQDDINGIQAIYGPSSKPIQPTGPSTPRACDPSLTFDAITTLRGEIFFFKDKYFWR
RHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLVFLFKDMITKGNSWNQVIPKAQQKS
FRNRK
Download sequence
Identical sequences F7DGQ3
ENSCJAP00000006811

Jump to [ Top of page · Domain architecture · Domain assignment details ]