SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCJAP00000015773 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015773
Domain Number 1 Region: 313-508
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-69
Family Hemopexin-like domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 115-284
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.9e-54
Family Matrix metalloproteases, catalytic domain 0.000000044
Further Details:      
 
Domain Number 3 Region: 25-98
Classification Level Classification E-value
Superfamily PGBD-like 2.98e-20
Family MMP N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58

Protein sequence

External link(s) Protein: ENSCJAP00000015773   Gene: ENSCJAG00000008538   Transcript: ENSCJAT00000016665
Sequence length 582
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:46892603:46902842:1 gene:ENSCJAG00000008538 transcript:ENSCJAT00000016665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPSRCLLLPLLMLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPKS
FSEAIAAMQKFYGLQVTGKADADTIKAMRRPRCGVPDKFGAEIKANVRRKRYAIQSVKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAIRVWESATSLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSSPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTLGNANLDGNDIFLVAVHE
LGHALGLEHSNDPSAIMAPYYQWMDTENFVLPDDDRRGIQQLYGSESGSPTKIPPQSWTT
SRPSVPDKPKKPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPLPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPAGGRPDEGTEEETEVIIIEVDEEGSGAVSAA
AVVLPVLLLLLVLAVGLAIFFFRRHGTPRRLLYCQRSLLDKV
Download sequence
Identical sequences F7DBK0
ENSCJAP00000015773 ENSCJAP00000015773 ENSCJAP00000015785 ENSCJAP00000042261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]