SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCJAP00000015773 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015773
Domain Number 1 Region: 313-508
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-69
Family Hemopexin-like domain 1.08e-05
Further Details:      
 
Domain Number 2 Region: 115-284
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.9e-54
Family Matrix metalloproteases, catalytic domain 4.4e-08
Further Details:      
 
Domain Number 3 Region: 25-98
Classification Level Classification E-value
Superfamily PGBD-like 2.98e-20
Family MMP N-terminal domain 0.0024
Further Details:      
 

Protein sequence

External link(s) Protein: ENSCJAP00000015773   Gene: ENSCJAG00000008538   Transcript: ENSCJAT00000016665
Sequence length 582
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:46892603:46902842:1 gene:ENSCJAG00000008538 transcript:ENSCJAT00000016665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPSRCLLLPLLMLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPKS
FSEAIAAMQKFYGLQVTGKADADTIKAMRRPRCGVPDKFGAEIKANVRRKRYAIQSVKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAIRVWESATSLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSSPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTLGNANLDGNDIFLVAVHE
LGHALGLEHSNDPSAIMAPYYQWMDTENFVLPDDDRRGIQQLYGSESGSPTKIPPQSWTT
SRPSVPDKPKKPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPLPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPAGGRPDEGTEEETEVIIIEVDEEGSGAVSAA
AVVLPVLLLLLVLAVGLAIFFFRRHGTPRRLLYCQRSLLDKV
Download sequence
Identical sequences F7DBK0
ENSCJAP00000015773 ENSCJAP00000015785 ENSCJAP00000042261 ENSCJAP00000015773

Jump to [ Top of page · Domain architecture · Domain assignment details ]