SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCJAP00000017339 from Callithrix jacchus 73_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017339
Domain Number 1 Region: 277-469
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.03e-66
Family Hemopexin-like domain 1.16e-06
Further Details:      
 
Domain Number 2 Region: 101-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.11e-57
Family Matrix metalloproteases, catalytic domain 3.59e-07
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 8.48e-19
Family MMP N-terminal domain 0.00076
Further Details:      
 

Protein sequence

External link(s) Protein: ENSCJAP00000017339   Gene: ENSCJAG00000009452   Transcript: ENSCJAT00000018341
Sequence length 469
Comment pep:novel chromosome:C_jacchus3.2.1:11:538535:550540:-1 gene:ENSCJAG00000009452 transcript:ENSCJAT00000018341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLLLLLQATASGALPLNSSTSLEKDNELFGERYLEKFYGLEKNKLPVTKMKAVRTLL
EEKIQEMQHFLGLNVTGRLDTSTLEMMHTPRCGVPDVHHFTTMAGRPVWKKHYITYSIQN
YTPDMNRKDVDYVIQKAFQVWSHVTPLKFSKTNAGVADIVMFFASGAHGDYNAFDGRGGV
IAHAFGPGYGIGGDTHFDEDEFWTINSKGTNLFLVAVHEIGHALGLDHSSDPNAIMFPTY
KYVDVSTFRLSADDIRGIQSLYGRPKEYQPLPKPDNSKPAPCDPNLSFDAVTTMGDKIFF
FKDRFLLTTSPQRPKASVSLISSLWPTLPSSIEAAYEIEARNQVFLFKDDRYWLISNLRP
QPNYPKSIRSFGFPNFVKKIDAAVYNPRLHKTYFFIDNQYWRYDERRQSMDPGYPKLITK
NFPVTGHKIDAVFSKNRYYYFFQGANQFEYDFLSQRVTKRLKHNSWFGC
Download sequence
Identical sequences F7IH65
ENSCJAP00000017339 ENSCJAP00000017339

Jump to [ Top of page · Domain architecture · Domain assignment details ]