SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017339 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017339
Domain Number 1 Region: 277-469
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.03e-66
Family Hemopexin-like domain 0.00000116
Further Details:      
 
Domain Number 2 Region: 101-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.11e-57
Family Matrix metalloproteases, catalytic domain 0.000000359
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 8.48e-19
Family MMP N-terminal domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.45
endopeptidase activity 1.576 149.51
zinc ion binding 1.567 42.55
growth factor receptor binding 2.175 16
cytokine receptor binding 1.96 16
enzyme activator activity 1.426 14.68
integrin binding 1.558 12.31
fibronectin binding 2.151 10.88
serine hydrolase activity 1.585 10.2
peptide transporter activity 1.652 9.95
Cellular Component IC (bits) H-Score
Golgi lumen 2.204 18.78
brush border 1.374 15.66
neuron projection terminus 2.128 10.01
exocytic vesicle 1.966 9.77
Golgi membrane 1.599 9.32
trans-Golgi network 1.734 9.32
vacuolar part 1.526 6.31
host intracellular part 1.994 5.4
dendrite 1.581 5.09
lysosomal membrane 1.908 5.02

Protein sequence

External link(s) Protein: ENSCJAP00000017339   Gene: ENSCJAG00000009452   Transcript: ENSCJAT00000018341
Sequence length 469
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:538535:550540:-1 gene:ENSCJAG00000009452 transcript:ENSCJAT00000018341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLLLLLQATASGALPLNSSTSLEKDNELFGERYLEKFYGLEKNKLPVTKMKAVRTLL
EEKIQEMQHFLGLNVTGRLDTSTLEMMHTPRCGVPDVHHFTTMAGRPVWKKHYITYSIQN
YTPDMNRKDVDYVIQKAFQVWSHVTPLKFSKTNAGVADIVMFFASGAHGDYNAFDGRGGV
IAHAFGPGYGIGGDTHFDEDEFWTINSKGTNLFLVAVHEIGHALGLDHSSDPNAIMFPTY
KYVDVSTFRLSADDIRGIQSLYGRPKEYQPLPKPDNSKPAPCDPNLSFDAVTTMGDKIFF
FKDRFLLTTSPQRPKASVSLISSLWPTLPSSIEAAYEIEARNQVFLFKDDRYWLISNLRP
QPNYPKSIRSFGFPNFVKKIDAAVYNPRLHKTYFFIDNQYWRYDERRQSMDPGYPKLITK
NFPVTGHKIDAVFSKNRYYYFFQGANQFEYDFLSQRVTKRLKHNSWFGC
Download sequence
Identical sequences F7IH65
ENSCJAP00000017339 ENSCJAP00000017339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]