SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|55627|Genemark1.571_g from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|55627|Genemark1.571_g
Domain Number 1 Region: 85-161
Classification Level Classification E-value
Superfamily SBT domain 3.14e-31
Family SBT domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|55627|Genemark1.571_g
Sequence length 661
Sequence
MGDPPFEYGAPRHDWNIEDIDWDPNEVQGELRASGSQDASAEASSAGAAQQVASSSGPTH
ESGGDVPVVLDTLQSMGSTKRRVPMQCQVDGCNKDLSVEKEYYQRYRICEEHLKLSSLLK
DGVQQRFCQQCGRFHLLADFDGDKRSCRARLDLHNNRRRKRGEAGDGSFRSSARLERRLG
EALHSRVSPRTRTRRVASRSRRSPLPSTDDEMTEDNSEVEQAARPRQAASSAAEAEEGTP
ARERRYATRQATAAAMRKHSYNPALDFEKQLYPPNIAETLAALQRGAGPHEPSQAAHSRM
SLQEGSSWDSSMLSAEGRQRFVAEHMLRHLSDPVQSMRDTLRQHSESGLDLRRNVLLMNS
LSSPTYMPSNIERSAERSAAHGSLEQDFRESLERSSDIYQQQGAAPLPYGGPFSEALGAT
GLSHYAAQLLYKCASDPVAQDTFGRPNLPPAAIAGVHIAPGSAGGAAGGGGGSGEARRII
SYSSEPTSISSSGLAKFPSEPFIRPRTVYPQYSAFDLPPGEFHDVAWPGPPNAPSAEEVK
HEQLSFRQGPTKRFFETAEGSTQGARARSRAQQQRGEQPRRGSMDAGAASQTAGSVLPFT
LPGGMAFSMGPLSSLGQSSGSGGLSRMPSAEEVVASMQREPSTERRMGRISLAHSLDIMQ
Q
Download sequence
Identical sequences I0ZAG5
jgi|Coc_C169_1|55627|Genemark1.571_g XP_005652178.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]