SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|61925|Genemark1.2708_g from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|61925|Genemark1.2708_g
Domain Number 1 Region: 149-224
Classification Level Classification E-value
Superfamily SBT domain 1.31e-22
Family SBT domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|61925|Genemark1.2708_g
Sequence length 1380
Sequence
MPAAAAAAMKFTSDGDTAAGVAKPRWRPCVRAVGVLCRGWWRTAVPGTEQSDALSVLGSA
RAKEVRPYRHQAPRLKRTAPRPCSVPEAPFEQVKPFGMRLDLLHRSSSGLSSDRGQAVPQ
LLTLQRSLALPLLLNAPNGLQRQDRGPAVEDCTRDVCELSTYHFRYRICNVHIRLPAFMR
QGKLQRFCQQCGRCHELSEFEGSQRSCRAQLDRHNARRRQAKKNAAAAKGPGAGSAAHAA
GASASGQYSSSTSLPASSSGGGGAVPRGGRSGAGEAGLLGPRRSRDPALSAAAAGLFSGA
DDEDAAADAATLLSVSQPRPALLPQPEQQPSASRLGSSRLSAFAQYSGEPAVGDAATAAR
TGSGAMRAVTPTDASERRLGSQMLRQGSEKSRQQQITSSSESAAAGVYDTSPGRADAEEA
TSQARRQSHSVGEEAASLEPAVRRRSGNLPAHGNERVGSAPGPSGKTSPSPGAASRFLDS
AAAQGFAAVLSRAAAAALQEAAAEQPPKMHDIVPGVAAGVQMGPIEPQPTPFSALASASL
SEAPTTQLSISPRAPEAMSATFPPSVSPAAATAAVDLKSGIQASRSLSESMLPGESPPSW
AGTAKRTASVARPLDRSGLMSATGAPSVSNSAAGSAELLAARSRLALERNAMVLRGLQQS
MAADGSGRKVSSSASIALTQRGNSTQSSMDLYVPDAAAAAAASASGADAAAARLPSADKS
PNRPPPFPQPPRGGQPGRAAQGEASPQQQEPYEDAVRHWLHFGQQIAASTKPGPQGLLPH
SLGLQAVNYLAGEVGAAAASAEAGVQELPLPVQLAGKEDRQVLAGSLPEGLRTALGLSMG
QPVGQPQRKGTHIDAPALAAAGEGPGAAVAPPSLLSQAEAAAAAAAQPSQTVQAQLAASA
AAAAAQQSLYLPMARSTAQIGMAGADQAGAAAAAVAGAAQLQAANPLSYQFYQMLLGSMA
SAAPKQQLQQQQAAFLENVAAANAAALLSFRAEAFAVHLCVKLFHCTPADLPEDAREQLL
GWLKGAPACTELYIRSGCVHLTVTAYVDVVTYQQVLANGAAQAAHHLIAQASQVWRRGVM
LVEVMNRAVLVSDGVPGPEFGLDAVCSGAFSRVEPPVAMAGQVCVLEAHGGPAAADIADS
AVLCRANGRYYDTQVEEVTGLAAGAGRKFFVRLPPDIPPGVIYLELQHGPFVGGACPALV
MPPERAAAAVELLQALRARDALLKGGWLPADQCLAISRATTDALLCQMGLVMRALSHGTS
DVAPSSALPRPEGVPEALVLVSSLQQPASAALAYGMLQFACTWGLPHLSSFLLQSISLDR
STSAAVGMQQPSPLTVSTGASAGKDWTVSVPHSVMGGSGLDVLAKLAAQIGQQTVPAGQA
Download sequence
Identical sequences I0Z1H7
XP_005649040.1.71052 jgi|Coc_C169_1|61925|Genemark1.2708_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]