SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|65460|estExt_Genemark1.C_50268 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|65460|estExt_Genemark1.C_50268
Domain Number 1 Region: 58-136
Classification Level Classification E-value
Superfamily SBT domain 4.84e-24
Family SBT domain 0.00018
Further Details:      
 
Domain Number 2 Region: 584-721
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000218
Family Ankyrin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|65460|estExt_Genemark1.C_50268
Sequence length 837
Sequence
MRKRAFGHGWYQRRAAETSGGDETAWNLHDWNWDSQNFTATPKKGIVAAAKPCRAAKRCR
VEGCRRELSDLSAYHQKCRICDIHIKAPSFMRAGLKQRFCQRCGRCHELDAFEGSKRSCI
AQLAKHNARRRRQQGTTAASDDLSALSLDLATAQSNVLESLNSRTHSLHVPMSQALPPGF
SYQGLMGPDVALGIPIGVQGNMQAHTSAAMPLMMSSMQAPPTTSMVSSMEQALMQMGHPS
AAGQLESPQESITPEFADDKPGPIQQQPVTAASAVAAGLPAAAAYQANSLVVRLSVKLFN
CTPGDLPQGLREQLCNWLCATPAGAEGYIRPGCLHLTMQVHVDAAAEVAEGVMPVVESLL
EQPGELWRTHRMLLQRDAEVALVHDGQLQSVAVALSAQQPGNTQPLIREVLPKVVVCQEG
AHQDIAVQVTGVGLASADTTILARCHGHYLEVQVEGEQSEGDKSLLSLRLRGPAAPGLVW
VETQHGVMLSPATPLLILPAGLHDLAADVLRIVSSPAKQEASADSQRKCCDGFLADLGLV
ISQAGALPGPAGSTLEHPAEQLTCAAAQPGPPVTATLVTRTARHLLAFACDAGAPALAHF
LLPSASVGCRSAAEVVAAVDGVEAQGGSTLLHRAARSGSGPLLRGLLAWGSTNGYRWKAD
ARDANGLTPLHFTAIVPDADLAVHLLLACGCSPRVWFTAAADDGLTPAHFAARVGRNDLN
ERMLLLAQEAQPGSLPIKPGCGCTCGDACACSRSGICRCAAASEGPSCGGSGGHSSDAGA
VSSGGQSSAGGCCGSTGSCGGTVVYADSVPSACSSSDGALAPAGNRPMSACCVGVSL
Download sequence
Identical sequences I0Z1X9
jgi|Coc_C169_1|65460|estExt_Genemark1.C_50268 XP_005649192.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]