SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|67762|estExt_Genemark1.C_180179 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|67762|estExt_Genemark1.C_180179
Domain Number 1 Region: 76-155
Classification Level Classification E-value
Superfamily SBT domain 3.01e-32
Family SBT domain 0.0000789
Further Details:      
 
Domain Number 2 Region: 707-823
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000187
Family Ankyrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|67762|estExt_Genemark1.C_180179
Sequence length 1034
Sequence
MAENALDAKERLWNPQDWCWDPYNMLALASDRKGLAVAGKAVFGGLPYAVQPQLGPAASL
LLDDVNRSGCRGKGPAVCQVDGCSAELTGLKEYHQRYKICEFHLKVNSIIREGKRQRFCQ
QCGRFHDLTSFDGDKRSCRARLQRHNARRRKKPAESGGSGAKPGVKKPPPTPLMVKGSRD
FVRTDSSKQRQTSDSTMDQMSTPQGSLEASSRQQMSIKSGSMESQGTIRQLIRGGRTLPE
EGPSGQQLAARLQSSSFASEQMHVTGFGDSDGAPMTAGQSSVPSSNYGDIPPSTYAADSS
MENLDCLQDINFFAPQQSSPMPDYSDLNQAATQMQATFAADPAAMDLGQAAAASKDTTAF
LVEEARALLSYAGQYQALEYTAEEHFTRMSAKMFKCTPEQLPADLKANLLAMLQCGVNAL
EGYIRPGCVHLTLHAMLGPDAGAALQAGCHSGMGVRALVHNLVTASNDTLWRSETLLIQW
YEEVALVRYGKVLHVLSASGSRGVLPRLHSVSPLAVTSAAATTVKLIGSNIAAPDNTVLA
QSQGENVAIEVVSAEADMEGAPEEVSSMLEVAVPAGQRNGVVHLEVARGALLSGPKPLLI
LKDAAAAEEINQLAQGDSTGLDVDGFLLDMGRVLELKNAVAAAKFGTEVHVRTFAADDVA
VIAQIARRQLIVAINKGWLSVARLVLPVAMADAKSVAEAVRKLEELTDGLPLLHLAVRSQ
SASLVELLLEWTSVGGYELRAGTPGPHGLTALHLAAMLKDGGKLAALLTALCVDGATAWT
QAGSAGASPADLAIAMGNHGTHELVYQQLCDTMAASTKGSSDEELEDADMCDDEDYDDIE
VDSETGELLDLSEIICRVRGGGSDVDTLDAALHQHTKNGEPAHVEAAAKAQPEAARTATG
TAEPPQHAPIHKVSPDEAGRSDGSSYTSTSRSSSDANSLLSDWPSQSCDSLGLRKRSPDV
PPVREGVEFTPEQKGGSKGRDADYSSLYNIGSCIGLKVAPTVFDRTSAIGSALLIAACGA
LTLFFRYFGSIFLD
Download sequence
Identical sequences I0YMU2
XP_005644255.1.71052 jgi|Coc_C169_1|67762|estExt_Genemark1.C_180179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]