SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB01G40950.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB01G40950.1
Domain Number 1 Region: 204-299
Classification Level Classification E-value
Superfamily YccV-like 1.01e-24
Family YccV-like 0.004
Further Details:      
 
Weak hits

Sequence:  OB01G40950.1
Domain Number - Region: 158-186
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.0667
Family C-terminal UvrC-binding domain of UvrB 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB01G40950.1
Sequence length 335
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:1:24703255:24707542:-1 gene:OB01G40950 transcript:OB01G40950.1 description:"Uncharacterized protein "
Sequence
MQGIFACGSISLSHGAGFRPACLALDDLGMFYKINSVICGAYPWHWCVKKLHMRTNGRKM
NTTVRTNARWLFGGDGRSSSNARLERSEAANEDILIFYFQLDLQTRIQYALNIEQFDVAK
QLREKLTEIETEIIRQREAKRGSSKTEAQDKAINLLRVRADLQKAVGSENYAVAASLRDE
IAKLEAESLAVSAKALAYQNVKYAFRLGQKVRHKVHGYRAVICGMDPVCCESKSWMETAN
VENLSKGPNQPFYQVLVDVYADPELLVAYVAEENLAEAEVSEKGRFDHPYIEFLFFGEDT
AGDFIPIKQLREKYDQPRYEASGDEDDDDDGNTDS
Download sequence
Identical sequences J3L4D9
OB01G40950.1 XP_006644756.1.55871 XP_006644757.1.55871 XP_015688336.1.55871 XP_015688338.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]