SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389841874|ref|YP_006343958.1| from Cronobacter sakazakii ES15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389841874|ref|YP_006343958.1|
Domain Number 1 Region: 27-359
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.85e-96
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000000000341
Further Details:      
 
Domain Number 2 Region: 363-542
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 4.19e-55
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389841874|ref|YP_006343958.1|
Sequence length 550
Comment bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic [Cronobacter sakazakii ES15]
Sequence
MGLARKGLAVALLAGLSLLSGGASAWEQDKTYNITILHTNDHHGHFWRNEYGEYGLAAQK
TLVDSVRREVTAQGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLIGYDAMAVGNHEFD
NPLSVLRQQEKWAKFPLLSANIYQKSTNERLFKPWAIFKPQGIKIAVIGLTTDDTAKIGN
PEYFTDIEFRKPADEAKLVIQELQQNEKPDVIIAATHMGHYDNGDHGSNAPGDVELARAL
PAGALTMIVGGHSQDPVCMASENKKQVDYVPGTPCAPDRQNGTWIVQAHEWGKYVGRADF
QFRNGEMKLVRYQLIPINLKKKVTWDNGQTERVLYTPQIPENPQMLSLLTPFQKKGQAQL
MVKIGSVNGRLEGDRSKVRFVQTSMGHLILNAQIARTGADFAVMSGGGIRDSIEGGDITY
KDVLKVQPFGNTLVYVDMTGKEVLEYLTAVAQKKPDSGAYPQFANVSFTASGGTLNDVKI
KGEPVDPAKTYRMATLSFNATGGDGYPPIDKKPGYVNTGFVDAEVLKQYIQQSSPLDVNA
FEPKGEVSWQ
Download sequence
Identical sequences WP_004387266.1.100123 WP_004387266.1.10743 WP_004387266.1.11201 WP_004387266.1.14450 WP_004387266.1.15880 WP_004387266.1.17416 WP_004387266.1.19250 WP_004387266.1.21817 WP_004387266.1.22106 WP_004387266.1.22333 WP_004387266.1.2234 WP_004387266.1.22982 WP_004387266.1.24568 WP_004387266.1.25268 WP_004387266.1.26514 WP_004387266.1.2805 WP_004387266.1.28222 WP_004387266.1.29051 WP_004387266.1.2985 WP_004387266.1.30214 WP_004387266.1.30537 WP_004387266.1.34134 WP_004387266.1.34426 WP_004387266.1.34483 WP_004387266.1.360 WP_004387266.1.3715 WP_004387266.1.37173 WP_004387266.1.38225 WP_004387266.1.39049 WP_004387266.1.39764 WP_004387266.1.40036 WP_004387266.1.41665 WP_004387266.1.42223 WP_004387266.1.42482 WP_004387266.1.4622 WP_004387266.1.4870 WP_004387266.1.48882 WP_004387266.1.49554 WP_004387266.1.50354 WP_004387266.1.5082 WP_004387266.1.50864 WP_004387266.1.51998 WP_004387266.1.54721 WP_004387266.1.56561 WP_004387266.1.57355 WP_004387266.1.57820 WP_004387266.1.58258 WP_004387266.1.59680 WP_004387266.1.60586 WP_004387266.1.6095 WP_004387266.1.62753 WP_004387266.1.63198 WP_004387266.1.63385 WP_004387266.1.6369 WP_004387266.1.6429 WP_004387266.1.65768 WP_004387266.1.67106 WP_004387266.1.67166 WP_004387266.1.69145 WP_004387266.1.72500 WP_004387266.1.72972 WP_004387266.1.73174 WP_004387266.1.75231 WP_004387266.1.78906 WP_004387266.1.84145 WP_004387266.1.84278 WP_004387266.1.84685 WP_004387266.1.84694 WP_004387266.1.8793 WP_004387266.1.88335 WP_004387266.1.88549 WP_004387266.1.89078 WP_004387266.1.90098 WP_004387266.1.90251 WP_004387266.1.90986 WP_004387266.1.91115 WP_004387266.1.92291 WP_004387266.1.92451 WP_004387266.1.94763 WP_004387266.1.95253 WP_004387266.1.95290 WP_004387266.1.95648 WP_004387266.1.98129 WP_004387266.1.99856 gi|449309163|ref|YP_007441519.1| gi|389841874|ref|YP_006343958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]