SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340652 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340652
Domain Number 1 Region: 326-516
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.85e-49
Family Hemopexin-like domain 0.00056
Further Details:      
 
Domain Number 2 Region: 127-291
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1e-43
Family Matrix metalloproteases, catalytic domain 0.0000581
Further Details:      
 
Domain Number 3 Region: 40-100
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000000251
Family MMP N-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.204 18.78
brush border 1.374 15.66
neuron projection terminus 2.128 10.01
exocytic vesicle 1.966 9.77
Golgi membrane 1.599 9.32
trans-Golgi network 1.734 9.32
vacuolar part 1.526 6.31
host intracellular part 1.994 5.4
dendrite 1.581 5.09
lysosomal membrane 1.908 5.02
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.45
endopeptidase activity 1.576 149.51
zinc ion binding 1.567 42.55
growth factor receptor binding 2.175 16
cytokine receptor binding 1.96 16
enzyme activator activity 1.426 14.68
integrin binding 1.558 12.31
fibronectin binding 2.151 10.88
serine hydrolase activity 1.585 10.2
peptide transporter activity 1.652 9.95

Protein sequence

External link(s) HGL_H00000340652
Sequence length 525
Comment MMP28 (Homo_sapiens) matrix metallopeptidase 28
Sequence
MVARVGLLLHALPLLLWGGLDAAPAERVDQELREEAEAXXXXAFLEKYGYLNEQVSKAPP
STRFSIAIRQFQWVSQLPVSGVLDHATLHQMSRPRCGVADTDGHATWIERISAPFAGRRA
KMRRKKRFAKQGNKWYKQHLSYRLVNWPERLPEPEVRGAVHAAFQLWSNVSALEFWEAPA
TVPADIRLTFFQGDHNDGLSNAFDGPGGALAHAFLPRRGEAHFDLDERWSLSHRRGRNLF
VVLAHEIGHTLGLAHSPAPRALMAPYYKRLGRDALLSWDDVLAVQNLYGKPLGGSVGTQL
PGKLFTDFEAWNPHSSQGSRPETQSPKYCHSSFDAITVDGQQRLYIFKGSHFWEVAPDGN
VSDPCLLQERWAGLPPNIEAAAVTLDDGDFYFFKGSRCWRFQGAKSVWGSSQLCRAGGLP
RHPDAALFFPPLHRLILFKGARYYVLARGGLQVEPYYPRFLRDWGGVPEEVSGALPRPDG
SIIFFRDDRYWHLDQAKLRVTTSGCWATELPWMGCWFDNSGGALF
Download sequence
Identical sequences HGL_H00000340652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]