SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for HGL_H00000340652 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340652
Domain Number 1 Region: 326-516
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.85e-49
Family Hemopexin-like domain 0.00056
Further Details:      
 
Domain Number 2 Region: 127-291
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1e-43
Family Matrix metalloproteases, catalytic domain 5.81e-05
Further Details:      
 
Domain Number 3 Region: 40-100
Classification Level Classification E-value
Superfamily PGBD-like 2.51e-13
Family MMP N-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.957 173.75
endopeptidase activity 1.54 149.12
zinc ion binding 1.659 43.58
integrin binding 1.753 17.75
cytokine receptor binding 2.035 15.08
growth factor receptor binding 1.997 15.08
enzyme activator activity 1.401 14.47
amide binding 1.711 13.09
collagen binding 1.838 10.43
protein complex binding 1.491 8.07
Cellular Component IC (bits) H-Score
brush border 1.48 22.54
Golgi lumen 2.239 12.24
secretory granule 1.826 10.6
neuron projection terminus 2.106 10.52
lysosomal membrane 1.998 8.25
trans-Golgi network 1.797 7.99
coated vesicle 1.74 7.78
clathrin-coated vesicle 1.876 7.78
lytic vacuole 1.57 7.42
vacuolar part 1.621 7.11

Protein sequence

External link(s) HGL_H00000340652
Sequence length 525
Comment MMP28 (Homo_sapiens) matrix metallopeptidase 28
Sequence
MVARVGLLLHALPLLLWGGLDAAPAERVDQELREEAEAXXXXAFLEKYGYLNEQVSKAPP
STRFSIAIRQFQWVSQLPVSGVLDHATLHQMSRPRCGVADTDGHATWIERISAPFAGRRA
KMRRKKRFAKQGNKWYKQHLSYRLVNWPERLPEPEVRGAVHAAFQLWSNVSALEFWEAPA
TVPADIRLTFFQGDHNDGLSNAFDGPGGALAHAFLPRRGEAHFDLDERWSLSHRRGRNLF
VVLAHEIGHTLGLAHSPAPRALMAPYYKRLGRDALLSWDDVLAVQNLYGKPLGGSVGTQL
PGKLFTDFEAWNPHSSQGSRPETQSPKYCHSSFDAITVDGQQRLYIFKGSHFWEVAPDGN
VSDPCLLQERWAGLPPNIEAAAVTLDDGDFYFFKGSRCWRFQGAKSVWGSSQLCRAGGLP
RHPDAALFFPPLHRLILFKGARYYVLARGGLQVEPYYPRFLRDWGGVPEEVSGALPRPDG
SIIFFRDDRYWHLDQAKLRVTTSGCWATELPWMGCWFDNSGGALF
Download sequence
Identical sequences HGL_H00000340652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]