SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for HGL_H00000340652 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340652
Domain Number 1 Region: 326-516
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.85e-49
Family Hemopexin-like domain 0.00056
Further Details:      
 
Domain Number 2 Region: 127-291
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1e-43
Family Matrix metalloproteases, catalytic domain 5.81e-05
Further Details:      
 
Domain Number 3 Region: 40-100
Classification Level Classification E-value
Superfamily PGBD-like 2.51e-13
Family MMP N-terminal domain 0.0087
Further Details:      
 

Protein sequence

External link(s) HGL_H00000340652
Sequence length 525
Comment MMP28 (Homo_sapiens) matrix metallopeptidase 28
Sequence
MVARVGLLLHALPLLLWGGLDAAPAERVDQELREEAEAXXXXAFLEKYGYLNEQVSKAPP
STRFSIAIRQFQWVSQLPVSGVLDHATLHQMSRPRCGVADTDGHATWIERISAPFAGRRA
KMRRKKRFAKQGNKWYKQHLSYRLVNWPERLPEPEVRGAVHAAFQLWSNVSALEFWEAPA
TVPADIRLTFFQGDHNDGLSNAFDGPGGALAHAFLPRRGEAHFDLDERWSLSHRRGRNLF
VVLAHEIGHTLGLAHSPAPRALMAPYYKRLGRDALLSWDDVLAVQNLYGKPLGGSVGTQL
PGKLFTDFEAWNPHSSQGSRPETQSPKYCHSSFDAITVDGQQRLYIFKGSHFWEVAPDGN
VSDPCLLQERWAGLPPNIEAAAVTLDDGDFYFFKGSRCWRFQGAKSVWGSSQLCRAGGLP
RHPDAALFFPPLHRLILFKGARYYVLARGGLQVEPYYPRFLRDWGGVPEEVSGALPRPDG
SIIFFRDDRYWHLDQAKLRVTTSGCWATELPWMGCWFDNSGGALF
Download sequence
Identical sequences HGL_H00000340652

Jump to [ Top of page · Domain architecture · Domain assignment details ]