SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMEL003422-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL003422-PA
Domain Number 1 Region: 536-759
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.33e-56
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000586
Further Details:      
 
Domain Number 2 Region: 1356-1581
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.5e-54
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000698
Further Details:      
 
Domain Number 3 Region: 997-1214
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.04e-53
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000625
Further Details:      
 
Domain Number 4 Region: 29-304
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.61e-53
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0002
Further Details:      
 
Domain Number 5 Region: 1580-1790
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.53e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000584
Further Details:      
 
Domain Number 6 Region: 764-977
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 7.46e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000502
Further Details:      
 
Domain Number 7 Region: 315-525
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.83e-36
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00036
Further Details:      
 
Domain Number 8 Region: 1219-1358
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 6.41e-32
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMEL003422-PA
Sequence length 1821
Comment pep:novel scaffold:Hmel1:HE668993:99925:135614:1 gene:HMEL003422 transcript:HMEL003422-RA description:""
Sequence
MTRLPQITTVLAVVAFSSSSIVKSPEIQENNFELLILHNNDMHASVKEARRAAAAGEGPP
VLYLNAGDTYTGTAWFTIYKWKIAAEFLNALQPDAVNFANDDLVKGHSNLTPFVENIGTM
ILASNIVIKSEIAKQKIQKSIIKEIQGIKIGIVGFLTPKSDILDSIGDIEYIDEVIAVQE
EVQKLKLQNVKIIIALGNSDKGKDIEIASEVDGVDLIISGHKNMFFSNGSNAEPDFEEEI
KPFVIQQKTGKQIPIIQSHAYNKYFGKILAVFNDNGDIISYQVDQLLLDESIPQDSQILG
IIKESAVNIASSNVAVGNTVVTLDGETCGLEECNFGNLVLDSIVFHYASKFEGDQWTDAP
IAIINGFAFAGKIIPNNNPISTSDLLSIIPENDVLVTVTMNGTVLNHILEYSVSDYIKNG
GSSQFLQFSGIRATFDLAKDPNSRLTSAVVRCWDCLVPQFFSIDDWREYKIIMPSSLARG
SHGYSILADLPKEELEYDVITCVADYIERRSPVYPEVAERIILLNQESAPDSAIALSPTI
LSLGNHEFDNGISGLTPFIRNLTCPVLAANLLLTKEPDLQAEHNLMNSVIFNINGVKVGV
IGYLTPDTQILAVKNNVVYIEEVIALNKEVTKLKNEGVKIFIALGHSGFTKDLEIAEKVD
DIDLVIGGHTNTFLWNGTAPDAETIQGPYPTLVKQPSSGRLVPVVQAYAYTKYLGKLHLV
FNSEGELIKYKGNPILLNNSIPQDPEVLAVVDRYRKNIIKISDVVVGMSSVVLDGLSCRL
QECNMGNLITDAIVDKYASEYKGDGWTDAPVAVVQGGGIRASIAHVDQRFNVSKGDLFTV
MPFDGNIVKIKINGSNIWKMLEHSVAGYNVVRAPGQFLQMSGLKVEYDFKKQPGRRVLSV
QVLCGKCQIPTYSPVNISESYYILTNAFLSMGGDGFSIFNGLLSTNLNYNELSCTVDYMN
RTSPVHPAVEGRIIIHNKSSSNDATNRIISKVLLIICSLGNHEFDQGVGGLTPFINNLTC
PVLAANLILTHAPELEKETNLKKSVIFNISGTSIGVVGYLTPETKMLALKNDVEYVEEIT
ALKEEVKKLKNQGVHIIIGLGHSGYLKDLQIAKEVQGLNLVIGGHSNTFLWNGTSPDSEV
SLGPYPTYVAQASGKQVPVVQAYAYTKYLGKLHMVFNDKGDLVSADGIPILLDKNIPQDP
DVLNIVDRYRTEILNYTEEVIGTTTVVLDGLSCQHNECNMGNLITDAMVYYYASEYDGKD
HWTDVPMAIIQGGGIRSSIAHADMPTSITKGDLIGVMPFEGNLVVVTVNGSMLLQMLEHS
IENLNDLDYPGEFLQMSGIKTVYDVRRPVGSKVVRAESLGNHEFDEDVDGLIPFIRSLTI
PTVTANLILNKVPGLKKEPNLHNSIILNRNGVKIGIIGYLTPDTKFLAPKNDVEYEDEIT
AIKREVQKLKIKGIKIFIALGHSGYYKDLDIAENVEDLDLVIGGHSNTFLTNKNNTNEIP
EYRQGPYPTVVEQKSGRKVLVVQAYAYTKYLGKLFLTFNSQGEITHYNGEPLLLDAKIPE
DPEVLQLVDSYRNDIDEIYNEIVGSSSVLLDGDSCRLKECNLGNFINDAIINYTKKNYNE
HSDINISIVQGGRIRSSISHPGYPFNITKGDMITVMPFSDSLCIITMNGTTLKKALEHSV
ANWRKIDTPGQFLQYSGIEVVYDLSQSPGSRIVTAKGMCITCSELNDITDDLQYKIMTSV
FIADGGDGYTIFQNLPREILTYNEVTCTIDYLRRYSPIKPSVSNRIVILNEDKIQNFVLS
KAHSINTSTMSLFIICIFMLL
Download sequence
Identical sequences HMEL003422-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]