SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29171705|ref|NP_803182.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|29171705|ref|NP_803182.1|
Domain Number - Region: 481-604
Classification Level Classification E-value
Superfamily Putative modulator of DNA gyrase, PmbA/TldD 0.0157
Family Putative modulator of DNA gyrase, PmbA/TldD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29171705|ref|NP_803182.1|
Sequence length 606
Comment melanoma-associated antigen D2 [Homo sapiens]
Sequence
MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKA
SGVSKATEVSKTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPA
TETKKVSHVADTKVNTKAQETEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKV
KHLDGEEDGSSDQSQASGTTGGRRVSKALMASMARRASRGPIAFWARRASRTRLAAWARR
ALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQGRANDLVKYLLAKDQTKIPI
KRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLSTLEPTDAGIL
GTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF
VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAME
ADLKAAAEAAAEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAK
AQESGSASTGASTSTNNSASASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGA
CGFSYK
Download sequence
Identical sequences A0A024R9Y7 Q9UNF1
gi|19387846|ref|NP_055414.2| gi|29171705|ref|NP_803182.1| gi|41350320|ref|NP_957516.1| ENSP00000218439 ENSP00000364193 ENSP00000364198 ENSP00000364209 ENSP00000379526 ENSP00000218439 NP_055414.2.87134 NP_055414.2.92137 NP_803182.1.87134 NP_803182.1.92137 NP_957516.1.87134 NP_957516.1.92137 9606.ENSP00000218439 ENSP00000218439 ENSP00000364193 ENSP00000364198 ENSP00000364209 ENSP00000379526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]